(data stored in ACNUC7421 zone)

EMBL: CP002355.PE199

CP002355.PE199       Location/Qualifiers
FT   CDS_pept        197300..197668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0200"
FT                   /product="LSU ribosomal protein L14P"
FT                   /note="COGs: COG0093 Ribosomal protein L14; InterPro
FT                   IPR019972: IPR005745: IPR000218; KEGG: cjd:JJD26997_2071
FT                   50S ribosomal protein L14; PFAM: ribosomal protein
FT                   L14b/L23e; SPTR: 50S ribosomal protein L14; TIGRFAM:
FT                   ribosomal protein L14; PFAM: Ribosomal protein L14p/L23e;
FT                   TIGRFAM: ribosomal protein L14, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32867"
FT                   /db_xref="GOA:E4TXV4"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXV4"
FT                   /protein_id="ADR32867.1"
FT                   /translation="MIQSFTRLAVADNTGAKELMCIKVLGGSKRRYATVGDVIIASVKK
FT                   AAPTGKIKKGQVVTAVVVRTKKEVHRENGSLIRFDENAAVILDKKREPIGTRIFGPVSR
FT                   EVRYAGFMKIVSLAPEVV"
     atgattcaaa gttttactcg tttagcggta gccgataaca caggagctaa agagcttatg        60
     tgtatcaagg ttcttggcgg ttcaaaacgt cgttatgcaa cagtaggtga tgttatcatc       120
     gcttctgtta aaaaagcggc tccaaccggt aagatcaaaa aaggtcaagt tgttacagca       180
     gttgttgtac gtacgaaaaa agaagttcac cgtgaaaacg gttcacttat ccgtttcgac       240
     gaaaatgcag ccgtaatcct tgataaaaaa cgtgagccga tcggtacacg tattttcgga       300
     ccagtaagcc gtgaagttcg ttatgctgga ttcatgaaaa tcgtatcact tgctccagag       360
     gttgtatga                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page