(data stored in ACNUC7421 zone)

EMBL: CP002355.PE200

CP002355.PE200       Location/Qualifiers
FT   CDS_pept        197668..197898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0201"
FT                   /product="LSU ribosomal protein L24P"
FT                   /note="COGs: COG0198 Ribosomal protein L24; InterPro
FT                   IPR003256: IPR005824; KEGG: tdn:Suden_0297 50S ribosomal
FT                   protein L24; PFAM: KOW domain protein; SMART: KOW domain
FT                   protein; SPTR: 50S ribosomal protein L24; TIGRFAM:
FT                   ribosomal protein L24; PFAM: KOW motif; TIGRFAM: ribosomal
FT                   protein L24, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32868"
FT                   /db_xref="GOA:E4TXV5"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXV5"
FT                   /protein_id="ADR32868.1"
FT                   /translation="MAKFNFKKGDIVEVIAGDDKGTKAELLQVMPKKNKVIVKGCRVAK
FT                   KAIKPSEQNPQGGFLNKEMPIDASNVRKVEA"
     atggcaaaat ttaatttcaa aaaaggcgat atcgttgaag taatcgccgg tgacgataaa        60
     gggactaaag cagaattgct tcaagttatg cctaagaaaa acaaagtaat cgttaaaggt       120
     tgccgtgttg ctaaaaaagc aatcaaacct agcgaacaaa atccacaagg cggatttttg       180
     aacaaagaga tgccgatcga tgcatcgaat gtccgcaaag tagaggcata a                231
//

If you have problems or comments...

PBIL Back to PBIL home page