(data stored in ACNUC7421 zone)

EMBL: CP002355.PE201

CP002355.PE201       Location/Qualifiers
FT   CDS_pept        197901..198446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0202"
FT                   /product="LSU ribosomal protein L5P"
FT                   /note="COGs: COG0094 Ribosomal protein L5; InterPro
FT                   IPR002132; KEGG: tdn:Suden_0298 50S ribosomal protein L5;
FT                   SPTR: 50S ribosomal protein L5; PFAM: ribosomal L5P family
FT                   C-terminus; Ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32869"
FT                   /db_xref="GOA:E4TXV6"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXV6"
FT                   /protein_id="ADR32869.1"
FT                   /translation="MARLKDKYLALKPELQTTLGIANVMQVPALEKVIISVGCGFAMKD
FT                   NKLIQNIQDTISNIAGQRAMVVNARKSVAGFKVREGMPVGVKVTLRGAQMYDFMDKLIS
FT                   VSLPRVKDFRGIPRNGFDGRGNYNFGITEQLIFPEVDYDSIMQIHGMNITVVTSATADK
FT                   DAFKLLEMLGMPFAKGRE"
     atggcacgac taaaagataa atatttggct cttaaaccag agcttcaaac aactttaggg        60
     attgcaaacg taatgcaagt tcctgctttg gaaaaagtga tcatctctgt cggttgtggt       120
     tttgccatga aagacaataa attgatccaa aacatccaag acacgatcag caacattgcc       180
     ggtcaacgtg cgatggttgt taatgctcgc aaatcagttg cgggatttaa agtacgtgaa       240
     gggatgccgg tcggtgttaa agtgacacta cgcggtgctc aaatgtatga tttcatggac       300
     aaattgatct ctgtatcact tccgcgtgtt aaagacttcc gtggtattcc acgtaacggt       360
     tttgacggtc gcggtaacta caacttcggt attaccgaac agttgatttt cccggaagtt       420
     gattacgatt caattatgca aatccacggg atgaacatca ctgtggttac atctgcaaca       480
     gctgacaaag atgcgttcaa gcttcttgaa atgctcggta tgccgtttgc taaagggaga       540
     gaataa                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page