(data stored in ACNUC7421 zone)

EMBL: CP002355.PE203

CP002355.PE203       Location/Qualifiers
FT   CDS_pept        198674..199069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0204"
FT                   /product="SSU ribosomal protein S8P"
FT                   /note="COGs: COG0096 Ribosomal protein S8; InterPro
FT                   IPR000630; KEGG: tdn:Suden_0300 30S ribosomal protein S8;
FT                   PFAM: ribosomal protein S8; SPTR: 30S ribosomal protein S8;
FT                   PFAM: Ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32871"
FT                   /db_xref="GOA:E4TXV8"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXV8"
FT                   /protein_id="ADR32871.1"
FT                   /translation="MINDLIADSLTRIRNAAMRRLDSTTLVHSKVVEAVVAILADKGYI
FT                   ESFNVVEDGVKKTINVVLKYDEKGRTVINEVKRVSKPGRRVYKGKDELKRFKNGYGTII
FT                   VSSSKGVLPNDKAFELGVGGEVLCTIW"
     atgattaatg atttgatcgc ggattcgttg actcgtatcc gtaatgcggc tatgcgtcgt        60
     ttagattcta caacattggt acactctaaa gttgtagaag ctgtggttgc cattttggca       120
     gacaaaggct acatcgagag ctttaacgtt gttgaagacg gcgttaaaaa aacaatcaat       180
     gtagtattga aatacgacga aaaaggtcgt acggttatta atgaagtaaa acgtgtctct       240
     aaaccgggac gtcgtgttta caaaggtaaa gatgaactaa aacgtttcaa aaacggttac       300
     ggtaccatca ttgtcagcag ttctaaaggg gttcttccta acgataaagc attcgagctt       360
     ggcgtaggcg gagaagtcct ttgtacaatt tggtaa                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page