(data stored in ACNUC7421 zone)

EMBL: CP002355.PE204

CP002355.PE204       Location/Qualifiers
FT   CDS_pept        199079..199615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0205"
FT                   /product="LSU ribosomal protein L6P"
FT                   /note="COGs: COG0097 Ribosomal protein L6P/L9E; InterPro
FT                   IPR002358: IPR000702: IPR019906: IPR020040; KEGG:
FT                   tdn:Suden_0301 50S ribosomal protein L6; PFAM: Ribosomal
FT                   protein L6, alpha-beta domain; SPTR: LSU ribosomal protein
FT                   L6P; TIGRFAM: ribosomal protein L6; PFAM: Ribosomal protein
FT                   L6; TIGRFAM: ribosomal protein L6, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32872"
FT                   /db_xref="GOA:E4TXV9"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXV9"
FT                   /protein_id="ADR32872.1"
FT                   /translation="MSRIGKLPISIPADVKATLEGTVLTFTKGATTQTLDTLGNCGVAL
FT                   DGNTLTFSTNSDQRTDRAFWGTYRALAANIITGLTTGFEKKLEINGVGYRAAVNGNVLN
FT                   LQLGFSHDINYDIPAGISMAVEKNVISIKGADKQQVGQIAAEIRSFRPPEPYKGKGVKY
FT                   SDETILRKAGKTSKK"
     atgtcacgta ttggaaaact tcctatttct atccctgctg atgtaaaagc aacgcttgag        60
     ggaactgtat tgacatttac caaaggtgca acaacacaga ccttggatac tcttggtaac       120
     tgcggtgtag cgcttgacgg taatactttg acgtttagca caaattctga tcaacgtact       180
     gatcgcgctt tctggggcac ataccgtgca ttggcagcaa acatcattac aggtttgact       240
     accggttttg agaaaaaact ggaaatcaac ggggttggtt atcgtgcagc ggttaacggg       300
     aatgtattga atcttcaact cggtttcagt catgatatca actacgatat tccagccgga       360
     atttcaatgg cagttgagaa aaacgttatc agcatcaaag gtgcagacaa acaacaagtt       420
     ggtcaaatcg ctgctgagat ccgatcattc cgtccacctg agccgtacaa aggtaaaggt       480
     gttaaatatt ctgatgagac tatcctgcgt aaagccggta agacatctaa gaaataa          537
//

If you have problems or comments...

PBIL Back to PBIL home page