(data stored in ACNUC7421 zone)

EMBL: CP002355.PE205

CP002355.PE205       Location/Qualifiers
FT   CDS_pept        199627..199983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0206"
FT                   /product="LSU ribosomal protein L18P"
FT                   /note="COGs: COG0256 Ribosomal protein L18; InterPro
FT                   IPR004389: IPR005484; KEGG: tdn:Suden_0302 50S ribosomal
FT                   protein L18; PFAM: ribosomal protein L18P/L5E; SPTR: 50S
FT                   ribosomal protein L18; TIGRFAM: ribosomal protein L18;
FT                   PFAM: Ribosomal L18p/L5e family; TIGRFAM: ribosomal protein
FT                   L18, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32873"
FT                   /db_xref="GOA:E4TXW0"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXW0"
FT                   /protein_id="ADR32873.1"
FT                   /translation="MTGKTLKNKSAKRLQRKRRIRSKISGCASLPRVSIFRSNRYISAQ
FT                   AINDEAAVTLAAVHSKTLGLKANKADAEKAAAVFAKNLKDAGISEVTFDRNGFLYHGVV
FT                   KAFAEALRANEIKF"
     atgacaggta aaacacttaa aaacaaatcg gcaaaacgtc ttcagcgtaa gcgccgtatt        60
     cgctctaaaa tttctggatg cgcgtcattg ccgcgtgttt ctattttccg ctcaaaccgc       120
     tacatcagcg cgcaagcgat caatgatgaa gcagcggtaa cattagcagc agtacactca       180
     aaaactttgg gtcttaaagc gaacaaagcc gatgctgaaa aagcggcggc agtatttgct       240
     aaaaacctca aagatgccgg gatcagtgaa gttacgttcg atcgtaacgg atttttgtat       300
     cacggtgttg taaaagcgtt tgccgaagca cttcgtgcaa atgaaatcaa gttttaa          357
//

If you have problems or comments...

PBIL Back to PBIL home page