(data stored in ACNUC7421 zone)

EMBL: CP002355.PE206

CP002355.PE206       Location/Qualifiers
FT   CDS_pept        199993..200436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0207"
FT                   /product="SSU ribosomal protein S5P"
FT                   /note="COGs: COG0098 Ribosomal protein S5; InterPro
FT                   IPR018192: IPR005712: IPR013810: IPR005324; KEGG:
FT                   tdn:Suden_0303 30S ribosomal protein S5; PFAM: Ribosomal
FT                   protein S5; ribosomal protein S5 domain protein; SPTR: 30S
FT                   ribosomal protein S5; TIGRFAM: ribosomal protein S5; PFAM:
FT                   Ribosomal protein S5, N-terminal domain; Ribosomal protein
FT                   S5, C-terminal domain; TIGRFAM: ribosomal protein S5,
FT                   bacterial/organelle type"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32874"
FT                   /db_xref="GOA:E4TXW1"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXW1"
FT                   /protein_id="ADR32874.1"
FT                   /translation="MQAINREEFSEAIVNIGRVTKVVKGGRRFRFTALVVVGNKKGTVG
FT                   YGVGKAKEVPDAIRKAVDEAFKNLTEVKIKGTTIAHDIEVKYNASRILLKPASEGTGVI
FT                   AGGATRPVLELAGIQDILTKSLGSNNPNTVVRATIDALSRIKG"
     atgcaagcga ttaacagaga agaattttca gaagcgattg taaacatcgg tcgtgtaact        60
     aaagttgtaa agggtggtag acgttttcgt tttaccgctc tagtcgttgt aggaaataaa       120
     aaaggaaccg taggttacgg agtcggaaaa gcgaaagaag ttccagacgc tatccgtaaa       180
     gcggtcgacg aagcgttcaa aaatttgaca gaagttaaga tcaaaggtac taccattgct       240
     catgacatcg aagttaaata taacgcgagt cgtatcttgc ttaaacctgc atcagaaggt       300
     acaggggtta tcgccggtgg cgctacccgt ccggtacttg agcttgcggg aatccaagac       360
     attttgacga agtctttggg ttctaacaat ccaaacaccg tggtacgtgc aacaatcgat       420
     gcactatcac gtattaaagg ataa                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page