(data stored in ACNUC7421 zone)

EMBL: CP002355.PE207

CP002355.PE207       Location/Qualifiers
FT   CDS_pept        200440..200838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0208"
FT                   /product="LSU ribosomal protein L15P"
FT                   /note="COGs: COG0200 Ribosomal protein L15; InterPro
FT                   IPR005749; KEGG: ccv:CCV52592_1015 50S ribosomal protein
FT                   L15; SPTR: 50S ribosomal protein L15; TIGRFAM: ribosomal
FT                   protein L15; PFAM: Ribosomal protein L18e/L15; TIGRFAM:
FT                   ribosomal protein L15, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32875"
FT                   /db_xref="GOA:E4TXW2"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXW2"
FT                   /protein_id="ADR32875.1"
FT                   /translation="MALENLTPAEGSTHSKKRLGRGQGSGQGKTAGKGHKGQKARKGYN
FT                   EKRNFEGGQQPLARRLPKFGFTSRVVKPTTINVEKVKEIAALSEITMETIRSVHRLAKS
FT                   VVSVKLVGASAKDLASKIKDENVTTTGN"
     atggcattag aaaaccttac tcctgctgag ggttctaccc acagcaaaaa acgtcttgga        60
     cgtggtcaag gaagcggtca gggtaaaact gccggtaaag gtcacaaagg tcaaaaagcg       120
     cgtaaaggtt acaatgaaaa acgtaacttt gagggtggac aacaaccact tgctcgccgt       180
     ttgccgaaat tcggttttac atcacgtgtt gttaaaccga caacaatcaa tgttgaaaaa       240
     gtaaaagaga ttgccgcact ttcggaaatc actatggaaa ccatccgtag tgtacaccga       300
     ttggcaaaat cggttgtcag cgttaaactt gttggcgcaa gcgctaaaga tttagcatct       360
     aaaatcaaag atgaaaacgt tacaacaact ggtaactaa                              399
//

If you have problems or comments...

PBIL Back to PBIL home page