(data stored in ACNUC7421 zone)

EMBL: CP002355.PE208

CP002355.PE208       Location/Qualifiers
FT   CDS_pept        200838..202100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0209"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /note="COGs: COG0201 Preprotein translocase subunit SecY;
FT                   InterPro IPR002208; KEGG: tdn:Suden_0305 preprotein
FT                   translocase subunit SecY; PFAM: SecY protein; SPTR:
FT                   Preprotein translocase subunit secY; TIGRFAM: preprotein
FT                   translocase, SecY subunit; PFAM: eubacterial secY protein;
FT                   TIGRFAM: preprotein translocase, SecY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32876"
FT                   /db_xref="GOA:E4TXW3"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXW3"
FT                   /protein_id="ADR32876.1"
FT                   /translation="MNQQLVNKILITIGFLFIYRLLAYVPVPGVDTAVIASFFNSHQAD
FT                   ALGLFNMFSGNAVERLSIISLGIMPYITASIIMELLAATFPNLAQMKKERDGMVKYMQI
FT                   IRYATIVITIVQAIGVSVGLQSMTGQDGASAILVDHSTFVTLAVVSMLAGTMLLMWIGE
FT                   QITQSGIGNGVSLIIFAGIVSAIPSAISQAVTMVNTGAMGFLSLLGIIALIIATILVII
FT                   YVELGERRIPVTYAKKTMMQNQNKRVMNYIPVKVNLSGVIPVIFASAILMFPMTVMSSS
FT                   TNPTVQAIADVLNPNHYFFNFLTFLFVVFFAFFYASIVFNAKDISENLKRQGGFIPGVR
FT                   PGESTKEFLNDTAGRLTITGAIYLGLIATLPWVIVKAMGVPFFFGGTAVLIVVQVALDT
FT                   MRRIEAQVYMSKYQTLSAVGL"
     atgaaccaac aacttgtaaa caagatctta attacgatcg gttttctttt catctaccgt        60
     ctactggcat acgtgccggt accgggtgtt gacacagccg ttatcgcttc attttttaac       120
     tctcatcaag ctgacgcgtt aggtctattc aatatgttca gcggtaacgc cgtagaacgt       180
     ctctcgatca tctctctggg tatcatgcct tatatcaccg catctatcat catggaactt       240
     ttagcagcga ctttccctaa cttagcgcaa atgaaaaaag agcgtgacgg tatggttaaa       300
     tacatgcaaa ttatccgtta tgcaacgata gtgattacga ttgttcaggc aatcggagtg       360
     agcgtcggac tgcaaagcat gaccggacaa gacggcgcga gcgctatttt ggtcgatcac       420
     agtacatttg taacgttggc agtcgtttcg atgcttgcgg ggacaatgtt gttgatgtgg       480
     atcggtgagc agattacgca aagcggaatc gggaacggtg tgtcgttaat catttttgcg       540
     gggattgttt cggcaattcc gagtgcgatt tcgcaagcag taacaatggt aaataccgga       600
     gcgatgggat tcttgtcgtt acttggaatt attgccctta ttattgcaac gattttggtc       660
     atcatctatg ttgagcttgg agaacgccgt ataccggtta cctatgcgaa aaagacgatg       720
     atgcaaaatc aaaataaacg ggttatgaac tacattccgg tcaaagtgaa tctttcaggg       780
     gttattccgg ttattttcgc ttcggctatt ttgatgttcc cgatgactgt tatgtcttcg       840
     agcactaatc cgacggttca agcgattgca gacgtactta acccgaacca ttatttcttt       900
     aactttttga catttctatt tgttgtattt tttgcgtttt tctatgcgtc aatcgtgttc       960
     aatgcaaaag atatttcaga gaatcttaaa cgtcaaggcg gatttatccc tggtgttaga      1020
     ccgggtgaat caacgaaaga gtttttgaat gacacggcgg gacgtttgac gattaccggg      1080
     gctatttatc tcggattgat cgcaacattg ccgtgggtta tcgttaaagc gatgggagta      1140
     ccgttcttct tcggagggac ggcggttttg atcgttgttc aggttgcact ggatacgatg      1200
     cgtcgtattg aagcgcaagt gtacatgtct aaatatcaaa ccctcagcgc ggttggcctg      1260
     taa                                                                    1263
//

If you have problems or comments...

PBIL Back to PBIL home page