(data stored in ACNUC7421 zone)

EMBL: CP002355.PE211

CP002355.PE211       Location/Qualifiers
FT   CDS_pept        203145..203786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0212"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="COGs: COG0790 FOG: TPR repeat SEL1 subfamily;
FT                   InterPro IPR006597; KEGG: ara:Arad_2749 hypothetical
FT                   protein; PFAM: Sel1 domain protein repeat-containing
FT                   protein; SMART: Sel1 domain protein repeat-containing
FT                   protein; SPTR: Putative uncharacterized protein; PFAM: Sel1
FT                   repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32879"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXW6"
FT                   /protein_id="ADR32879.1"
FT                   /translation="MKKYLYLLFFLVTPLFSSEGQQSFWETYTDALRGNKEAQFQVGVI
FT                   FERGIGREENQSLAAQWFEKSAEQGHVDAQYNVAIMYAAGRGVDVDEGKAMMWLAKAAK
FT                   QKDKEARKLLNDIIDGKLDKKSSDAVNNYHDAVSDNSFEMITPTTLMTKEGAKVCDQKG
FT                   ICIALKANTALTSTSKNRQFYKISGTVTKKGWQEYKKEGWIDENSVEIRR"
     atgaaaaaat acttatacct gctcttcttt cttgttactc cactcttttc ttcggaagga        60
     caacaatctt tttgggaaac ctatacggat gctctgcgcg gtaacaaaga agcgcagttt       120
     caagtcggcg ttatatttga gcgcggaatc ggtagagagg aaaatcagtc gctggcggca       180
     caatggtttg aaaaatcggc agaacaaggg catgtggacg cgcaatacaa tgtagcgatc       240
     atgtatgcgg ccggacgggg agtcgacgtg gatgagggta aagcgatgat gtggcttgcc       300
     aaagcggcga aacaaaaaga taaagaagca cgaaaactac ttaacgacat tattgacggg       360
     aaactggata aaaaatcatc cgatgccgta aataattatc atgatgcagt ttcggacaac       420
     tctttcgaaa tgatcacccc gacaaccctg atgacaaaag agggtgcaaa agtctgcgac       480
     caaaaaggga tatgtatcgc acttaaggct aatacagctt taacgtcaac atcaaaaaac       540
     aggcaattct ataaaataag cggaacggtc actaaaaaag ggtggcaaga gtataaaaaa       600
     gagggttgga ttgatgagaa cagcgtcgag atacgacgct ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page