(data stored in ACNUC7421 zone)

EMBL: CP002355.PE212

CP002355.PE212       Location/Qualifiers
FT   CDS_pept        complement(203795..204112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0213"
FT                   /product="protein of unknown function DUF1255"
FT                   /note="COGs: COG3123 conserved hypothetical protein;
FT                   InterPro IPR009664; KEGG: tdn:Suden_2102 hypothetical
FT                   protein; PFAM: protein of unknown function DUF1255; SPTR:
FT                   UPF0345 protein Suden_2102; PFAM: Protein of unknown
FT                   function (DUF1255)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32880"
FT                   /db_xref="GOA:E4TXW7"
FT                   /db_xref="InterPro:IPR009664"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXW7"
FT                   /protein_id="ADR32880.1"
FT                   /translation="MSQFINVTIDKKANVYFDGKVTSRTVHFADGSIKTLGIMAPGEYT
FT                   FGTADKEIMEIMSGEMDIQLPGSDAWITINGPMSFEVPANSSFNLKVKTISDYCCSYIK
FT                   E"
     atgtcacagt tcatcaacgt cactatcgac aaaaaagcca atgtttattt cgacggaaaa        60
     gttaccagcc gtacagttca ctttgccgac ggtagtatca aaactctcgg gatcatggct       120
     ccgggagaat atacgttcgg tacagccgat aaagagatca tggaaattat gagcggagaa       180
     atggatattc agcttcctgg ttcagatgca tggatcacga tcaacgggcc gatgagtttc       240
     gaagttccgg cgaacagctc ttttaaccta aaagtcaaaa cgatcagcga ctactgctgc       300
     agctacatta aagaataa                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page