(data stored in ACNUC7421 zone)

EMBL: CP002355.PE214

CP002355.PE214       Location/Qualifiers
FT   CDS_pept        complement(204347..205186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0215"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG2996 conserved hypothetical protein;
FT                   InterPro IPR014464; KEGG: tdn:Suden_0312 hypothetical
FT                   protein; SPTR: Nucleic acid binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32882"
FT                   /db_xref="InterPro:IPR014464"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039566"
FT                   /db_xref="InterPro:IPR040764"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXW9"
FT                   /protein_id="ADR32882.1"
FT                   /translation="MNETLKVGEINILVIDRSTVPGLFLRALDESDILLPNQYVTESMH
FT                   IGDTIDVFVYTDSEDRPVATTVKPKAMVNEIAFVEVVDTNSIGAFVDWGLPKDLFVPRA
FT                   LQKRPFAVGEKRLVRVILDDQTNRLVGTEKISGALETPPKSFYPNTPVEFMIIAKTPMG
FT                   YKVIVDHKYEGMIYANEIFEDVRVGQIKKGFVKLLRPDGKLDLSLQMVGKAKASSAADK
FT                   IFSMIQGNGGMLPYNYKSDPDLIQKTFGLSKKNFKAALTQLVDAKKITVQENGIYGI"
     atgaatgaaa cactaaaagt cggggagatc aatatcctcg ttatcgaccg ctctaccgtg        60
     ccggggttat tcctacgtgc tctggatgag agcgatatat tactgccgaa ccagtacgtc       120
     accgagtcga tgcatatcgg cgatacgatc gacgtattcg tctataccga cagcgaagac       180
     cgccctgtcg cgacaaccgt aaagcccaag gcgatggtga acgaaatcgc ctttgtcgaa       240
     gtggtcgata cgaattcgat cggtgccttt gtagactggg gactgccgaa agatcttttt       300
     gtccccagag cccttcaaaa acgtcccttc gccgtcgggg aaaaacggct ggttcgtgtc       360
     attctcgatg atcagaccaa ccgtcttgtc ggaaccgaaa agatcagcgg tgcattagag       420
     actcctccga agagttttta tccgaacacc cccgtagagt ttatgattat tgccaaaacc       480
     cctatggggt ataaagtgat agtcgatcat aaatatgagg ggatgattta cgccaatgaa       540
     atttttgaag acgtccgtgt cgggcagatc aaaaaaggat tcgtcaaact tttgcgtccc       600
     gacggaaagc tcgatctctc gttgcaaatg gtcggaaaag cgaaagcgtc cagtgccgcc       660
     gataaaattt tctcgatgat acaaggcaat ggaggaatgc tcccgtataa ctacaagagc       720
     gatcccgatt taatccaaaa aacgttcggg ctcagtaaga aaaatttcaa agcggccctg       780
     actcagctcg tcgatgctaa aaaaataaca gttcaggaga acggaatcta tgggatatag       840
//

If you have problems or comments...

PBIL Back to PBIL home page