(data stored in ACNUC7421 zone)

EMBL: CP002355.PE215

CP002355.PE215       Location/Qualifiers
FT   CDS_pept        205227..205979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0216"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COGs: COG0300 Short-chain dehydrogenase of various
FT                   substrate specificities; InterPro IPR020904: IPR002347:
FT                   IPR002198; KEGG: tdn:Suden_1903 short-chain
FT                   dehydrogenase/reductase SDR; PFAM: short-chain
FT                   dehydrogenase/reductase SDR; SPTR: Short-chain
FT                   dehydrogenase/reductase SDR; PFAM: short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32883"
FT                   /db_xref="GOA:E4TXX0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXX0"
FT                   /protein_id="ADR32883.1"
FT                   /translation="MRILITGASSGLGEVLALHYATKDNTLVLIARREDRLSDVASRCR
FT                   ELGADVETLVADVNDFERIREIGTELGQNPIDRIILNAGVSVGHNGGVTPFEDFERLFK
FT                   TNFLSIHALLEPIIPKLMEQRSGEIVFISSLASLLSMPTSIAYSSSKRALNAYAEGLHY
FT                   QLKPHGISVMTIMPGFIDSEMTRKNRFKMPFLLKTEEGVARIVRAIERKKIRYAFPFRF
FT                   YLMIRIVLLFPQSLRDKIVNFTNFKKGQ"
     gtgcggatac taataacagg tgcaagcagc ggtttgggag aagtgttggc tctacactac        60
     gcgacgaaag ataatacgtt ggtattgatt gcacgtagag aagacagatt atccgatgtg       120
     gcgagccgat gcagagagtt gggagcggac gtggaaacac ttgtagccga tgtcaacgat       180
     tttgagcgga taagagaaat agggacggaa ctcggtcaaa atccgattga ccgcattatc       240
     ctcaatgccg gtgtgtcggt cgggcataac ggcggagtga caccgtttga agattttgag       300
     cgtcttttca aaaccaactt tttgagtatt cacgcgctgt tggaaccgat tatccctaaa       360
     ttaatggagc aaagatcggg agaaatcgtc tttatttcat ctctcgcatc attgctcagt       420
     atgccgacat ctatcgccta cagcagttcc aaacgggcgc ttaacgcgta tgcggagggg       480
     ctgcattatc agctcaaacc gcatggaatt tccgtgatga cgattatgcc gggatttata       540
     gattcggaga tgacccggaa gaaccgtttt aagatgccgt tcttattaaa aacggaggaa       600
     ggggttgcgc ggattgtccg tgcgatagag cgaaaaaaaa tccgatacgc attccctttt       660
     agattttact taatgattcg aattgtattg ctgtttccgc agtccttaag agacaaaatt       720
     gtaaacttca ctaattttaa aaaggggcag tag                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page