(data stored in ACNUC7421 zone)

EMBL: CP002355.PE216

CP002355.PE216       Location/Qualifiers
FT   CDS_pept        206005..208080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0217"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="COGs: COG3383 Uncharacterized anaerobic
FT                   dehydrogenase; InterPro IPR006655: IPR006963: IPR006656:
FT                   IPR006657; KEGG: nis:NIS_1552 formate dehydrogenase, alpha
FT                   subunit; PFAM: molybdopterin oxidoreductase; molybdopterin
FT                   oxidoreductase Fe4S4 region; molydopterin
FT                   dinucleotide-binding region; SPTR: Formate dehydrogenase,
FT                   alpha subunit; PFAM: Molybdopterin oxidoreductase;
FT                   Molydopterin dinucleotide binding domain; Molybdopterin
FT                   oxidoreductase Fe4S4 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32884"
FT                   /db_xref="GOA:E4TXX1"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXX1"
FT                   /protein_id="ADR32884.1"
FT                   /translation="MTIDSVCTYCGVGCDISAEVEDNKIQKIFAKDEGVVSQGRLCIKG
FT                   KQGWDFLTHPKRLRNARVRKTFLAKNSALFADFDMDYLEPVDHDFYEISYESAYELAAR
FT                   KLKSITDEHGSHSFAAIGGARTSCESSYLFQHFTRHVVGSPHVDNCARVCHSPSLKGMR
FT                   TTIGEGAMSNPFDDIYETEFMVVMGSNTTEGHPIVANRMLDVIKNNGVELAVLDVRRIQ
FT                   LSKSATHHLSIPYEANLMILNMLAYVIISENLVNVEFVNSRTKGYEAYKSSILNDSYAN
FT                   PEFLLQIPGYESLVDDIRIVARKYATRKSLFFWGLGITEHLDGSYAVMAITHLAMLTGN
FT                   IGKRGAGLMPLRGQNNVQGTCDVGMLPYYAPDYQPPKEVGMMTPDLINAMCDGKIKALF
FT                   NISEDIAHIHPNQNKIHAALGNLDLLVVNELFDNEVTKFADIIFGVKSAYEKTGVYVNA
FT                   ERRLHLSQPLVRATMPDDWEVIAEISKRYGVDLGVASSYDVWEKVRADAPNRFGGASYE
FT                   KLEANRLRGLQWPVQEEDLPVLHIGTFRTKDGLGSFHYHQYSPRGQVEELLNVKSHEGY
FT                   YLTTGRILVHYNNGAQTNACDKLSRSHSEDTLLVSVEDEDFFEYKDFVVLKSEYGQSAP
FT                   LRVKVSSTVKKGTLFTTFHHAKSNINFLFGDECDELIKTARFKSIKVEVIKPDYLD"
     atgactatcg acagcgtttg tacttattgc ggtgtggggt gtgatatttc cgctgaggta        60
     gaagacaaca agattcaaaa aatctttgcc aaagacgagg gagtcgtttc acaagggcgc       120
     ctttgtatca aaggaaagca gggatgggat tttttgacgc atccgaaacg tttgcgcaat       180
     gcccgcgtcc gtaagacatt tttagcgaag aattccgcat tgtttgctga tttcgatatg       240
     gattatctcg aaccagtcga tcacgatttt tatgagatta gctatgagag tgcatatgag       300
     cttgccgcac gaaagctcaa atcgatcacc gatgaacacg gttcgcacag ttttgccgca       360
     atcggcggtg cccgtacaag ctgtgagagt tcctatctgt ttcaacattt tacccgccat       420
     gtggtcggtt cgccgcacgt cgacaactgc gcccgtgtct gccactcccc gtcattaaaa       480
     gggatgcgta cgacgatcgg cgagggggca atgagcaatc cgtttgacga tatttatgag       540
     acggaattta tggtagtgat ggggagcaat acgaccgaag ggcaccctat cgttgccaac       600
     cggatgcttg atgtcattaa aaacaacggg gtggagctgg cggtcctcga tgtccgcagg       660
     attcagctct cgaaatcagc gacgcatcat ttgagtatcc cgtatgaagc caacttgatg       720
     atacttaaca tgttggcgta tgtcattatt tccgagaatc ttgtcaatgt cgaatttgtt       780
     aatagccgga caaaagggta tgaagcgtat aaaagttcaa tcttgaacga ctcttacgcc       840
     aaccccgaat ttttattgca gattccggga tacgaatcgc tggtggatga tatccgtatc       900
     gttgcccgca aatatgcaac ccgaaaaagt ctttttttct ggggcttggg aattactgaa       960
     catcttgacg gatcgtatgc cgtgatggcg attacccatc tggctatgct gacaggcaat      1020
     atcggaaaac ggggagcggg attgatgccg cttcggggac agaacaatgt ccaggggacc      1080
     tgtgatgtcg ggatgcttcc gtactatgct cccgattatc aaccgcccaa agaggtgggg      1140
     atgatgaccc ctgatcttat taatgcgatg tgtgatggga aaataaaagc ccttttcaat      1200
     atcagtgaag atatcgccca tatccatccg aatcaaaata aaattcatgc ggcattgggc      1260
     aatctcgatc ttctagtcgt caatgaactc tttgacaacg aagtgactaa atttgccgac      1320
     ataattttcg gggtaaaaag tgcctatgag aaaacaggcg tttacgtcaa cgccgagcgc      1380
     cgactccacc tttcacaacc gcttgtacgg gcgacgatgc cggatgactg ggaagtgatt      1440
     gcggagatat ccaaacgtta cggtgtcgat ttgggcgttg catcctcgta tgacgtgtgg      1500
     gaaaaagtga gagccgatgc tccaaaccgt ttcggcgggg cgagttatga aaagcttgag      1560
     gctaaccgtt tgcggggatt gcagtggccg gtacaggaag aggaccttcc ggtattgcac      1620
     atcggtacgt ttcgaaccaa agacggctta gggtcgtttc attaccatca atactctccc      1680
     cgaggtcagg ttgaagagct tttaaatgtt aaaagtcatg aaggatatta tctgacgaca      1740
     ggacggattt tggtccacta caacaacggt gcccaaacca atgcgtgtga taaactcagt      1800
     cgcagtcaca gcgaagatac gctgttggtc agtgtcgagg atgaagattt ttttgaatac      1860
     aaagactttg tcgtccttaa aagcgaatac ggccaaagtg ctccgttacg ggtaaaagtg      1920
     agttcaaccg tcaaaaaagg gacccttttt acaacatttc accatgctaa gagcaatatt      1980
     aactttcttt tcggagatga gtgtgacgag ctgattaaaa cggcgcgttt caaatcaata      2040
     aaagtcgagg tgatcaaacc cgactacttg gattaa                                2076
//

If you have problems or comments...

PBIL Back to PBIL home page