(data stored in ACNUC7421 zone)

EMBL: CP002355.PE217

CP002355.PE217       Location/Qualifiers
FT   CDS_pept        208086..208421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0218"
FT                   /product="Uncharacterized protein family UPF0102"
FT                   /note="COGs: COG0792 endonuclease distantly related to
FT                   Holliday junction resolvase; InterPro IPR003509; KEGG:
FT                   ant:Arnit_2816 hypothetical protein; PFAM: Uncharacterised
FT                   protein family UPF0102; SPTR: UPF0102 protein Arnit_2816;
FT                   PFAM: Uncharacterised protein family UPF0102"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32885"
FT                   /db_xref="GOA:E4TXX2"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXX2"
FT                   /protein_id="ADR32885.1"
FT                   /translation="MHTRARGNLAEERGCDYLRGKGLRIIDRNVYNRFGEIDIIALSSD
FT                   NVLHFIEVKSGSSYEQAVNNITSSKLQKLNRTIQTYLQQKKLNLDYCIDALIISDETLE
FT                   WIENITL"
     atgcacactc gcgctcgtgg caatttagcc gaagagcggg gatgtgacta tttgagagga        60
     aaagggcttc gtatcattga taggaacgtc tataaccgtt tcggagaaat cgatattatt       120
     gcgctaagtt ccgataacgt tcttcacttt atcgaagtta aaagcggttc ctcgtatgaa       180
     caggcggtta acaatattac ctcttccaaa ctccaaaaac taaaccgtac gatccaaacc       240
     tatctccaac aaaaaaagct taatcttgat tattgcatcg atgcgctgat catcagcgat       300
     gagactctgg agtggattga aaatattacc ctttag                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page