(data stored in ACNUC7421 zone)

EMBL: CP002355.PE218

CP002355.PE218       Location/Qualifiers
FT   CDS_pept        complement(208418..210466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0219"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="COGs: COG2200 FOG: EAL domain; InterPro IPR000160:
FT                   IPR001633; KEGG: nam:NAMH_0258 diguanylate
FT                   cyclase/phosphodiesterase; PFAM: EAL domain protein; GGDEF
FT                   domain containing protein; SMART: EAL domain protein; GGDEF
FT                   domain containing protein; SPTR: Diguanylate
FT                   cyclase/phosphodiesterase; TIGRFAM: diguanylate cyclase;
FT                   PFAM: EAL domain; GGDEF domain; TIGRFAM: diguanylate
FT                   cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32886"
FT                   /db_xref="GOA:E4TXX3"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXX3"
FT                   /protein_id="ADR32886.1"
FT                   /translation="MKLSHKLALTAVLGGSALISLFLFKTFSHDYFTDRNKLGLNFKAI
FT                   ETAQNQLDNQILNNAFFLYTNQDGINDKINHVHKELDILLRNPHIIQEHPNTYAALQKY
FT                   RAQFNHKVNAIYDFQTTNIVIKNTTAALLASQQHLFEHDETTPQGQEVLYEINRLAGSI
FT                   LLAKNALDSELITSLRPKIAALEHYRFVNPKNEELTQRMISHFKVIEQYFPQFVKVTEQ
FT                   IKDPALSATLSEAETAFYRESDAELRFVSYFSYLLVTLFIISIGIIAIFLVQSEREARI
FT                   DPLTRLRNRKAYEEDLKRKGEKAALILININKFKHYNDFYGVKEGDRLLIETAHHIQNI
FT                   PFAGYNPSYYRLGADDFGILFELFDYNDLHAISKTFLKTFSERPILIDNEPRTPSISIS
FT                   ASKFSPLLETADMALKNKTHTNPTVYHQGLNLHQIIADNVTKARELKDALAENRIVPYF
FT                   QPIISLSTRSVTKHEVLARIIMKDDQARSIYPYLHIAKESNLYPQLTRAIVTQSFAIIA
FT                   EHEGDFSINVSIDDIGNKETVALLEQLLEQYESIGKRIIFELLESEAIEEYNEIVEFIV
FT                   KMRRYGCRIAIDDFGSGYSNFSRILNLAIDIIKIDGSLIRNLDTDDKAITIVQTIVNFT
FT                   KNSSIKTVAEFVHNEAIADIVEKLEIDSAQGFYFYEPARHPVTVGQP"
     atgaagctct cccataaact cgctttaacc gccgtgcttg gcggcagtgc actcatctca        60
     ttatttctct ttaaaacatt ttcacatgat tatttcactg atcgaaataa actcgggctt       120
     aattttaaag cgatagaaac agctcagaat cagctcgaca atcaaatctt aaataatgct       180
     tttttcctct ataccaatca agacggaatt aatgacaaaa tcaaccatgt tcacaaagag       240
     ctggatatcc ttcttcgcaa tccgcatatt attcaggagc atccaaacac ctatgcggct       300
     ctccaaaaat accgcgcaca atttaaccat aaagttaatg ccatctatga ttttcaaaca       360
     accaatatcg tcattaaaaa tacaactgca gcccttttag cctcacagca gcatttgttt       420
     gaacacgatg agaccacccc tcagggacaa gaggtactct acgagatcaa tcggttggcc       480
     ggttctattt tactggcaaa aaacgctttg gacagtgaac ttatcacatc tttgcgtccc       540
     aagattgctg ccctggaaca ctaccgtttt gtgaacccca aaaatgaaga gcttacacag       600
     cggatgatct ctcatttcaa agttatcgaa caatactttc cccaatttgt caaagtgacg       660
     gagcagataa aagatcccgc tttatcggct accctgagcg aagcagaaac agctttttac       720
     cgcgaatcgg atgctgaact tcgctttgtc tcctattttt cctatttgct agtcactctg       780
     ttcattatca gtatcggaat catcgccatc tttttggttc aaagcgagcg agaagcgaga       840
     atagaccctc ttacccggct tcgtaaccgt aaagcgtatg aagaagactt aaaacgaaaa       900
     ggtgaaaagg ccgcccttat cttgatcaat attaacaagt ttaagcacta caacgatttt       960
     tacggcgtga aagaggggga tcgtctctta atcgaaaccg cacatcatat acagaacatc      1020
     ccttttgcag gatacaaccc gtcttattac cgtctgggtg cggatgattt cggaatcctg      1080
     tttgaattat tcgactacaa cgatctccat gcaatttcca aaacatttct gaaaactttt      1140
     tccgagagac cgattctaat cgataatgaa ccccgtaccc cttccatttc aatctctgca      1200
     tccaaattct cgcctttgct ggaaacagcc gatatggcgc ttaagaacaa aacacatacg      1260
     aatcctaccg tctaccatca ggggcttaat ctccaccaaa tcatagccga caacgttacc      1320
     aaagcgagag aattaaaaga tgccctagcg gaaaatcgga tcgttccgta ctttcaaccg      1380
     attatcagcc tctctacccg gagcgttacc aaacacgagg tgttagcgcg tatcattatg      1440
     aaagatgatc aggcaaggtc catttatccc tatctccata tcgctaaaga gtccaatctc      1500
     taccctcaac ttactcgtgc cattgttacc cagagttttg ccataatcgc agaacatgag      1560
     ggagattttt caattaatgt atcgatcgat gatatcggaa ataaagaaac cgtagcactt      1620
     ctggaacaat tgctggaaca gtacgaatcg atcggaaagc ggattatttt cgaactgtta      1680
     gaatctgagg ctatcgaaga gtataatgaa attgttgagt tcattgtcaa aatgcgccgt      1740
     tacggttgtc gcatcgccat cgatgatttc ggcagcggtt attccaattt ttcacgcatt      1800
     ttaaatcttg ctatcgatat tatcaaaata gacggttcac tcatccgcaa tctcgatacc      1860
     gatgataaag ccataacaat cgttcaaacc attgtcaatt ttactaaaaa cagttccatc      1920
     aaaacggtcg ctgagtttgt ccataacgaa gccattgccg atatcgttga aaaactcgaa      1980
     attgattccg cgcaaggatt ctacttttat gaaccggcaa gacatcctgt cactgtcggg      2040
     cagccctaa                                                              2049
//

If you have problems or comments...

PBIL Back to PBIL home page