(data stored in ACNUC7421 zone)

EMBL: CP002355.PE22

CP002355.PE22        Location/Qualifiers
FT   CDS_pept        complement(24657..25079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0022"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ant:Arnit_1851 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32690"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW74"
FT                   /protein_id="ADR32690.1"
FT                   /translation="MSYKQWFDAHAAKHAAIMEKLTRLSDDEVIEYFRFENMVKNEPDF
FT                   CPLYAENKKCHDTEELNCYLCACPNFRFSDAGFAVEERKILFSTCSIESPDGDRYVSES
FT                   AIHQNCAGCIVPHRESYIKKVFDRDWLKIMKEVPSE"
     atgtcctata aacaatggtt cgacgcccat gcggccaaac acgccgcaat catggagaag        60
     ctcacccgcc tcagtgacga cgaggtgatc gagtatttcc ggttcgagaa catggtcaaa       120
     aacgagccgg atttctgccc cctttatgcg gagaataaaa agtgccacga cacagaggag       180
     ctcaactgct acctctgcgc ctgtcccaat tttcggttta gcgatgcggg gttcgcggtc       240
     gaagagagaa aaatcctctt cagcacctgc tctatcgaaa gccccgacgg cgaccgctat       300
     gtgagcgagt cggctatcca ccaaaactgc gccgggtgta tcgtccccca ccgcgagagc       360
     tatatcaaaa aagtgttcga tcgcgactgg ctcaaaatca tgaaagaggt gccgagtgaa       420
     taa                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page