(data stored in ACNUC7421 zone)

EMBL: CP002355.PE220

CP002355.PE220       Location/Qualifiers
FT   CDS_pept        211575..211892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0221"
FT                   /product="thioredoxin"
FT                   /note="COGs: COG3118 Thioredoxin domain-containing protein;
FT                   InterProIPR017937: IPR005746: IPR006662: IPR017936: IPR
FT                   013766; KEGG: wsu:WS0452 thioredoxin; PFAM: Thioredoxin
FT                   domain-containing protein; SPTR: THIOREDOXIN; TIGRFAM:
FT                   thioredoxin; PFAM: Thioredoxin; TIGRFAM: thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32888"
FT                   /db_xref="GOA:E4TXX5"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXX5"
FT                   /protein_id="ADR32888.1"
FT                   /translation="MGKYVELTVSNFDEITKEGVSLVDFWAPWCGPCRMIAPVIEELAA
FT                   EYEGKANICKVNTDEEQDIAVKYGIRSIPTILFFKNGEVVEQMVGAASKQAFADKLNAL
FT                   L"
     atgggtaaat acgttgaatt gacagtatca aattttgatg aaataaccaa agagggtgtc        60
     tcattggtag atttttgggc tccttggtgt ggaccttgcc gtatgatcgc tccggtcatc       120
     gaagaattgg cggcagaata tgaaggaaaa gcaaatatct gtaaagtaaa tacagatgaa       180
     gagcaagata ttgcggtaaa atacggtatc cgttctattc cgactatcct tttctttaaa       240
     aacggcgaag tcgttgaaca aatggtcggt gccgcatcaa aacaagcgtt tgctgataag       300
     ctgaacgctc tactgtaa                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page