(data stored in ACNUC7421 zone)

EMBL: CP002355.PE224

CP002355.PE224       Location/Qualifiers
FT   CDS_pept        215347..216309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0225"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG1242 Fe-S oxidoreductase; InterPro
FT                   IPR005911: IPR007197: IPR006638; KEGG: tdn:Suden_1872
FT                   hypothetical protein; PFAM: Radical SAM domain protein;
FT                   SMART: Elongator protein 3/MiaB/NifB; SPTR: Putative
FT                   uncharacterized protein; TIGRFAM: conserved hypothetical
FT                   protein; PFAM: Radical SAM superfamily; TIGRFAM: radical
FT                   SAM protein, TIGR01212 family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32892"
FT                   /db_xref="GOA:E4TXX9"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXX9"
FT                   /protein_id="ADR32892.1"
FT                   /translation="MRTQIFTFGQYLHRRFGAKVSKVPVSISGFTCPNIDGSVAKGGCT
FT                   FCENDSFSPSLDRARELKGFYLNLQSTSNPHLEKQLQQLEWQFQALSSRLSDENNAQKF
FT                   LVYFQSFTNTYAPLETLKALYEKALTFDNVVGLSIGTRSDSISDETFEYLADLSQKTEI
FT                   WIEFGIQSIYDTTLERINRGHDSANVKEAIRKAKSYGLNVCGHLIFGLPGETKEMMLET
FT                   AKEAYALGIDSVKYHPLYVVKRTALANEYARGEFEPIDEELYLEVLREAIVLKPSHVSV
FT                   QRISAGIGDESLIAPQWCKDKNRQLRSINKALESVGLKY"
     atgcgtactc aaatttttac attcgggcaa tatctgcatc gccgtttcgg ggcaaaagtt        60
     tcaaaggtcc ccgtatcaat ttcgggattc acctgcccta atatagacgg cagtgttgcc       120
     aaaggtggat gtactttttg tgaaaatgat tcttttagcc caagcttgga tcgagcacgc       180
     gaactaaagg gattttatct caatcttcaa tcaacctcca accctcattt agaaaaacag       240
     ctacagcagc ttgaatggca atttcaagcc ctttcatctc gtttgagtga tgaaaataat       300
     gcccagaagt ttttagtcta ttttcagagt tttaccaaca cttacgctcc tctggaaaca       360
     ctcaaagccc tttatgaaaa agcgctgaca ttcgataatg tagtcggact tagtatcgga       420
     acccgttcgg acagtatcag tgatgagaca tttgaatatt tggctgacct ttcgcaaaag       480
     acggaaatat ggattgagtt cgggatccag tccatttatg atactacgtt ggaacgtatc       540
     aatcggggac atgacagcgc caatgtaaaa gaggcgatac gaaaagcaaa atcgtatgga       600
     ctgaatgttt gcggacatct gattttcggt cttccgggcg aaacgaaaga gatgatgctg       660
     gaaaccgcga aagaggcgta tgcgctcggt atcgattcgg ttaaatatca tcctttgtat       720
     gtcgtaaaac ggacggcttt ggcaaatgag tatgcacggg gcgagtttga accgatagac       780
     gaagagcttt atttagaagt tctaagagaa gcgatcgtat taaaaccgtc ccatgtcagt       840
     gtccagcgca tcagcgccgg tatcggtgat gagagcttga ttgctccgca atggtgcaaa       900
     gataaaaata ggcaactccg ctccatcaat aaagcgctag aatcggttgg cctaaaatac       960
     tag                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page