(data stored in ACNUC7421 zone)

EMBL: CP002355.PE225

CP002355.PE225       Location/Qualifiers
FT   CDS_pept        complement(216317..216850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0226"
FT                   /product="DNA gyrase subunit B"
FT                   /note="KEGG: cco:CCC13826_2105 DNA gyrase subunit B; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32893"
FT                   /db_xref="GOA:E4TXY0"
FT                   /db_xref="InterPro:IPR013417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXY0"
FT                   /protein_id="ADR32893.1"
FT                   /translation="MSPLTIWHYLLIAVLILLLLIGFLVSLRTNSKFSVFTTISLTLML
FT                   IGFFTWRSINENVYIVEVSQLDQERFYQSEQIVLKGIVRNVGNYPVANVIATVKLINSH
FT                   GGVGGKQSLFTQPSVFAQIYEGDNPNFKRQTVEKEELVADYLNPGKAKPFTIIMKYPSY
FT                   FKHATFDVTAKAAY"
     atgagcccgt taactatttg gcattatctt ttaattgccg ttttaatact tctattactg        60
     attggatttc ttgtctccct tcgtacaaac tccaaatttt cagtttttac tacaatatct       120
     cttactctta tgctgattgg attttttacc tggagatcta ttaatgaaaa tgtctatatc       180
     gtggaagtct ctcaactgga tcaggagcgc ttttatcaat ctgaacagat tgttctcaaa       240
     gggatcgtac gcaatgtcgg aaactatccg gtagccaatg tcatcgctac cgtcaaactg       300
     atcaactctc atggcggagt cggcgggaag caatctttat ttacacagcc atccgttttt       360
     gcccaaatat atgagggaga caatcctaat tttaaacgcc agacagtcga aaaagaggaa       420
     cttgtcgctg attatttaaa tcctggaaag gcaaagccct ttacgattat tatgaaatac       480
     ccgtcatact ttaaacacgc tacgtttgat gtcacggcaa aagcagccta ttaa             534
//

If you have problems or comments...

PBIL Back to PBIL home page