(data stored in ACNUC7421 zone)

EMBL: CP002355.PE226

CP002355.PE226       Location/Qualifiers
FT   CDS_pept        complement(216847..217362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0227"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1874 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32894"
FT                   /db_xref="GOA:E4TXY1"
FT                   /db_xref="InterPro:IPR013417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXY1"
FT                   /protein_id="ADR32894.1"
FT                   /translation="MKTKIIDFIHHLIIYDYLLFGGIFILFLLFLVLAIALRHKMALAV
FT                   LFVVLAFGTLTAGSVAGYIQLHKYLFKNKIILHEVKALQYTEALLIKGDINNTSKRSFK
FT                   ECTITTGVYKVTHNKYLDRVYPYVPFKKSSQKFIKPIPPGESKPFKLFVEPFRYTKDYN
FT                   ITIKAECR"
     atgaaaacaa aaataatcga ttttatacac cacctcatca tctacgatta cctccttttc        60
     ggaggaattt ttattttatt tcttttattt ttggtattgg ccatcgccct tcgccacaaa       120
     atggctttag cggttctttt tgttgtctta gcgttcggaa cgctaaccgc aggatctgtt       180
     gcagggtata ttcaactgca taaatacctt tttaaaaata aaatcattct tcatgaagtg       240
     aaagcgcttc aatatacgga agcccttttg attaaaggcg atatcaacaa cacatcaaaa       300
     cgctctttta aggagtgcac cattactaca ggcgtctata aagtgactca caataaatat       360
     ttggatcgtg tttatcccta cgttcctttt aaaaaatcct cacaaaagtt tatcaagcct       420
     atccctccgg gcgaatcaaa accgtttaaa ctttttgttg aaccgttccg atatactaaa       480
     gactacaata tcactataaa ggcggaatgt cgatga                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page