(data stored in ACNUC7421 zone)

EMBL: CP002355.PE227

CP002355.PE227       Location/Qualifiers
FT   CDS_pept        complement(217359..218033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0228"
FT                   /product="phosphoribosyl-AMP cyclohydrolase;
FT                   phosphoribosyl-ATP pyrophosphatase"
FT                   /EC_number="3.6.1.31"
FT                   /EC_number="3.5.4.19"
FT                   /note="COGs: COG0139 Phosphoribosyl-AMP cyclohydrolase;
FT                   InterPro IPR008179: IPR002496: IPR021130; KEGG:
FT                   tdn:Suden_1875 phosphoribosyl-AMP cyclohydrolase; PFAM:
FT                   phosphoribosyl-AMP cyclohydrolase; Phosphoribosyl-ATP
FT                   pyrophosphohydrolase-like; SPTR: Histidine biosynthesis
FT                   bifunctional protein hisIE; TIGRFAM: phosphoribosyl-ATP
FT                   diphosphatase; PFAM: Phosphoribosyl-ATP
FT                   pyrophosphohydrolase; Phosphoribosyl-AMP cyclohydrolase;
FT                   TIGRFAM: phosphoribosyl-ATP pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32895"
FT                   /db_xref="GOA:E4TXY2"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023019"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXY2"
FT                   /protein_id="ADR32895.1"
FT                   /translation="MNLDLIDWQKSELLPVIVQDSTTLEVLMMAYMNREALELSLSTRI
FT                   AHYYSRSKKRLWKKGESSGHLQHIEQFLLDCDNDTLLLIVRQEGVACHTGRKSCFFTNI
FT                   ESGEAISRPLIDTAATYGIIDELYHTILSRKNADPSTSWTAKLLSKGDNTILKKVVEEA
FT                   GEFSFAIKDGNEDEIIYECADLVYHVLVALGHKNISPDRIKQELARRFGMSGIAEKNSR
FT                   EQ"
     atgaatctcg accttatcga ttggcaaaaa tcggaacttc ttcccgtaat cgttcaagac        60
     tccacgacac tggaagtctt gatgatggcc tatatgaacc gcgaagcatt ggagctctct       120
     ttatcgacgc ggatcgctca ctattattcc cgctccaaaa aacggctttg gaaaaaaggg       180
     gagtccagcg gacatcttca gcatatcgaa caattcttgc tcgattgcga taacgacacc       240
     ctcttgctga ttgtccgcca agaaggggtg gcctgccata ccggacgcaa atcgtgtttc       300
     tttaccaata tcgaaagcgg tgaggcgatt agccggcccc taatcgatac agcggcgact       360
     tacggtatca ttgatgaact ttatcacacc atcttgtcac gtaaaaatgc tgacccctct       420
     acctcttgga cagctaaact gctcagcaaa ggggacaaca ccatccttaa aaaagtagtc       480
     gaagaggcag gagagtttag ttttgcgatc aaagacggca acgaagatga aattatttat       540
     gaatgtgccg atttagtgta tcacgtctta gtagcactcg gacataaaaa tatatctccc       600
     gatcgtatca aacaagagct tgcccgacga tttgggatga gtgggattgc ggagaaaaac       660
     tcgcgggaac aatga                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page