(data stored in ACNUC7421 zone)

EMBL: CP002355.PE228

CP002355.PE228       Location/Qualifiers
FT   CDS_pept        complement(218104..219141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0229"
FT                   /product="SPFH domain, Band 7 family protein"
FT                   /note="COGs: COG0330 Membrane protease subunits
FT                   stomatin/prohibitin homologs; InterPro IPR000163:
FT                   IPR001107; KEGG: tdn:Suden_1876 band 7 protein; PFAM: band
FT                   7 protein; SMART: band 7 protein; SPTR: Band 7 protein;
FT                   PFAM: SPFH domain / Band 7 family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32896"
FT                   /db_xref="GOA:E4TXY3"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXY3"
FT                   /protein_id="ADR32896.1"
FT                   /translation="MASDMNDYFNKKKNEANRGGGFQSPKPPKMDFNLSGQKAGMLWII
FT                   GGILLLLVLAKPFIIITEGERGILSTNGKYEERALLPGLHFLIPFIQKVYLVDTKVRII
FT                   NYADKIDRASTAGDGIVLKPAITVLDKRGLPVTIELTVQYRLNPQVAAQTISNWGFSWE
FT                   DKIIDPVARDIVRNVVGQYEAENLPIMRNAIAQKIEVGIRNTVEGQKNAPAQLESIQLR
FT                   EIGLPQKVKDQIERVQVAKQEVERAQQDVERAKQEAFKKETEAQGTANAITIQAEAQAK
FT                   ANRLIGSSLTPGLLKLEQIQVQGKFNEALKENKDAKIFLTPGGSTPNIWLDTKTGDGQK
FT                   ISSTK"
     atggctagtg acatgaacga ctattttaat aagaaaaaaa atgaggcaaa ccgagggggc        60
     ggatttcagt ctccgaaacc gccaaaaatg gactttaacc taagcgggca aaaagccgga       120
     atgttatgga tcatcggcgg aatccttttg ctccttgttt tagcgaagcc gttcatcatt       180
     atcaccgagg gggaacgcgg tattctttcg acgaacggga aatacgaaga acgggcttta       240
     ttgccgggac ttcattttct tattccgttt atccaaaaag tctatctcgt cgataccaaa       300
     gtgcgtatca tcaactatgc cgataaaatc gatcgtgctt cgacagcggg ggatggcatc       360
     gtcctcaaac cggctattac cgttttggac aaacgggggc ttcccgtcac tattgaatta       420
     acggttcagt accgtcttaa tccgcaagtg gctgcacaaa cgatctcaaa ctggggattt       480
     agctgggaag acaaaatcat cgatccggta gcccgtgata tcgtccgaaa tgtcgtcggt       540
     caatatgaag cggaaaattt gccgattatg cgcaatgcca ttgcccaaaa aatcgaagtc       600
     ggaatccgca ataccgtaga ggggcagaaa aatgctcctg cccagcttga gtcgatccag       660
     ctccgtgaaa tcgggcttcc tcaaaaagta aaagatcaga ttgaacgtgt ccaagtagct       720
     aaacaagagg tcgaacgagc tcaacaagat gtagaacggg caaaacaaga agcattcaaa       780
     aaagagacgg aagcgcaagg aaccgcaaat gcgatcacta tccaagccga agctcaagcc       840
     aaagccaacc gactgatcgg ttcttccctt actccgggac tgttaaagct ggagcaaatc       900
     caagtgcaag gcaaattcaa tgaagcactg aaagaaaata aagacgccaa aattttcctg       960
     acaccggggg gttctacccc aaatatttgg ctcgatacca aaacaggcga tggacaaaag      1020
     atttcttcca cgaaataa                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page