(data stored in ACNUC7421 zone)

EMBL: CP002355.PE229

CP002355.PE229       Location/Qualifiers
FT   CDS_pept        complement(219196..220116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0230"
FT                   /product="branched chain amino acid aminotransferase
FT                   apoenzyme"
FT                   /EC_number="2.6.1.42"
FT                   /note="COGs: COG0115 Branched-chain amino acid
FT                   aminotransferase/4-amino-4-deoxychorismate lyase; InterPro
FT                   IPR005785: IPR001544; KEGG: tdn:Suden_1877 branched-chain
FT                   amino acid aminotransferase; PFAM: aminotransferase class
FT                   IV; SPTR: Branched-chain amino acid aminotransferase;
FT                   TIGRFAM: branched-chain amino acid aminotransferase; PFAM:
FT                   Aminotransferase class IV; TIGRFAM: branched-chain amino
FT                   acid aminotransferase, group I"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32897"
FT                   /db_xref="GOA:E4TXY4"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXY4"
FT                   /protein_id="ADR32897.1"
FT                   /translation="MNEAKYIWMNGKLLPWHDAKIHVLSHTLHYGNGAIEGTKAYKTPK
FT                   GYAIFRLNDHTKRLIESAKMTLINVPYTVEELNHAQIELLKANEFTGENVYLRPIVYLG
FT                   YGVMGVYHKEAPVEVAVSAWEWGAYLGEEGMKKGIRLKISSFSRPNNKSNMGKAKAVAN
FT                   YLNSQMAKFEAVEAGYDEALLLDDEGYVAEASGASFFMIKDGEIITPPNDNSLASITQK
FT                   TVIEMAEKMGYTVSRRRISREEIYIADEAFLTGTAAEITPVREVDARVLGAGGRGPITE
FT                   KIQSSYFDIVYGRNPDYDHYLTYIN"
     atgaatgaag ccaaatatat ttggatgaac ggtaaactgc tcccatggca tgacgcgaaa        60
     attcacgtcc tttcccatac actgcactac ggaaacggtg cgattgaagg gactaaagca       120
     tacaaaaccc cgaaagggta tgcgattttt cgtctgaacg accataccaa acgtctgatc       180
     gaatcggcaa aaatgacctt gatcaatgtc ccgtacaccg ttgaagaact caaccatgct       240
     caaatcgagt tgttaaaagc caacgaattt accggcgaaa atgtctatct ccgtccaatc       300
     gtttatctcg gatacggtgt tatgggtgtt taccacaaag aagcaccggt tgaagttgcc       360
     gtttccgcat gggaatgggg cgcctatctc ggcgaagagg ggatgaaaaa gggaatccgt       420
     cttaaaatct catcgttcag ccgcccgaat aacaaatcga atatgggtaa agccaaagcg       480
     gttgccaact atctcaacag ccaaatggca aaatttgaag cggttgaagc gggatacgac       540
     gaagcactgc tccttgatga tgaaggatac gtagccgaag cgagcggagc ttcatttttc       600
     atgataaaag acggagagat catcactccg ccaaacgata attcgcttgc gtcaatcacc       660
     caaaaaacgg ttatcgaaat ggcagaaaaa atgggttaca ccgtctcccg ccgacgcatc       720
     agccgcgaag aaatctacat cgccgatgaa gcattcctta ccggaactgc agctgaaatc       780
     acccctgtcc gcgaagttga cgcgcgtgtt ttaggagccg gcggacgcgg gccgatcacg       840
     gagaaaatcc aaagcagcta ttttgatatc gtctacggac gcaatccgga ttacgaccac       900
     tacctaacgt atataaatta a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page