(data stored in ACNUC7421 zone)

EMBL: CP002355.PE23

CP002355.PE23        Location/Qualifiers
FT   CDS_pept        complement(25069..26409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0023"
FT                   /product="adenosylcobyric acid synthase
FT                   (glutamine-hydrolysing)"
FT                   /EC_number="6.3.5.10"
FT                   /note="COGs: COG1492 Cobyric acid synthase; InterPro
FT                   IPR004459: IPR017929: IPR011698; KEGG: ant:Arnit_1837
FT                   cobyric acid synthase CobQ; PFAM: CobB/CobQ domain protein
FT                   glutamine amidotransferase; SPTR: Cobyric acid synthase
FT                   CobQ; TIGRFAM: cobyric acid synthase CobQ; PFAM:
FT                   CobQ/CobB/MinD/ParA nucleotide binding domain;
FT                   CobB/CobQ-like glutamine amidotransferase domain; TIGRFAM:
FT                   cobyric acid synthase CobQ"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32691"
FT                   /db_xref="GOA:E4TW75"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW75"
FT                   /protein_id="ADR32691.1"
FT                   /translation="MRSISIFGTSSDAGKSTLTFVIGRLLQERGINVGVFKAQNVSNNS
FT                   RVCDDGSEIAVAQYFQAEVLGIPTSYHLNPVLLKSGHGNSASLIVKGRVVEDKEVREYY
FT                   RDLDQLKPAVNECFEYLSERYECLVCEGAGSPVELNLMDKDLSNIYIAQKYNTKIILVA
FT                   DIERGGVFASIWGVYNLLPEALRKNVIGVIINKFRGDRSLFDEGVTIIEERFGIPVLGV
FT                   LPYLPLNLGFEDSQSLKNFIQNKPHPAQKIGIIAYPTMSNYNDFEPLIADESIFVEFIT
FT                   SNVALESFDCVILPGSKRVIEDLRWLKKTGLFDAIQKREKEILGICGGYQMMFTEIIDE
FT                   ECVETPEPSREEALGFIDDAIVFQKEKVLTKGEYSIFGKTVRGFEIHHGVSGKYPLWYE
FT                   KGHIKGTFVHGLFEDEAFEEYKQKTVGDFIATMRDEIDMERILEHVL"
     atgagatcga tctctatttt cggcacctcc tccgatgcgg gaaaatcaac cctcaccttt        60
     gtgatcggca gacttttgca ggagcggggg atcaacgtcg gggtgttcaa agcccaaaac       120
     gtctccaaca actcccgcgt ctgcgacgac gggtctgaaa tcgccgtcgc ccagtatttt       180
     caggcggagg tgttggggat tccgacgagc taccatctca atccggtact gttgaaatcg       240
     gggcacggca acagcgcctc attgatcgtg aaagggcgcg tcgtggagga taaagaggtg       300
     cgggagtact accgcgacct cgatcagtta aagcccgccg taaacgagtg ttttgagtat       360
     ctgagtgagc ggtatgagtg cctcgtttgc gagggggcgg ggagccccgt cgagctgaac       420
     ctgatggaca aagacctctc caatatctat atcgcgcaaa agtacaatac gaagattatc       480
     ctcgtcgccg atatcgaaag ggggggcgta ttcgcctcga tctggggggt ctacaacctc       540
     ctccccgaag ctttacgaaa gaacgtcatc ggcgtcatca tcaacaaatt ccgcggcgat       600
     cggagcctgt ttgatgaggg ggtgacgatt atcgaggagc ggttcggcat acccgtactc       660
     ggcgtcctcc cctatctccc cctcaacctc ggattcgaag actcccagag cctcaaaaac       720
     ttcatccaaa acaaacccca ccccgcacaa aagatcggga tcatcgccta tccgacgatg       780
     agcaactaca acgatttcga acccctcatc gccgatgaga gtatcttcgt cgagttcatc       840
     acctccaacg tggcgctgga gagtttcgat tgcgttatcc tccccgggag caaacgggtc       900
     atcgaggatc tgcggtggct caaaaagacg gggctgttcg atgcgatcca aaaaagagag       960
     aaagagatac tcggcatctg cggcggatat cagatgatgt tcactgaaat catcgacgag      1020
     gagtgtgtcg agaccccaga accgagtcgc gaagaagctc tcgggtttat cgacgacgcc      1080
     atcgtgtttc aaaaagagaa agtgctcaca aagggggaat attcgatctt cgggaaaacg      1140
     gttcggggat tcgagattca tcacggggtg agtggcaaat atccgctgtg gtatgagaag      1200
     ggtcacatca aagggacgtt tgttcacgga ctgttcgagg acgaagcgtt tgaggagtac      1260
     aagcaaaaaa cggtgggtga tttcatcgcg acgatgagag acgaaatcga tatggagagg      1320
     attttggaac atgtcctata a                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page