(data stored in ACNUC7421 zone)

EMBL: CP002355.PE230

CP002355.PE230       Location/Qualifiers
FT   CDS_pept        complement(220226..220675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0231"
FT                   /product="globin"
FT                   /note="COGs: COG2346 Truncated hemoglobins; InterPro
FT                   IPR001486; KEGG: abu:Abu_1553 hypothetical protein; PFAM:
FT                   globin; SPTR: Protozoan/cyanobacterial globin family
FT                   protein; PFAM: Bacterial-like globin"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32898"
FT                   /db_xref="GOA:E4TXY5"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXY5"
FT                   /protein_id="ADR32898.1"
FT                   /translation="MLELKITDGVLGVRPPVTKPHPGFFFQVGEERFRKLVDDHYEKIR
FT                   NSDIAFLFPVNDEEDFANAKKHAADFLIQICGGPDYFAQTRGEPRMVGRHAPFRIDEHG
FT                   RRRWLEFYAELLPPLEAEGINPEYIQSFWDYLDIFSIWMINTPSH"
     atgcttgaac ttaaaattac cgacggtgtt ttaggcgtac gccctcccgt caccaaaccc        60
     catccgggat ttttcttcca agtgggagaa gaacggttcc gtaaactcgt cgatgatcac       120
     tacgagaaga tccgtaacag cgatatcgct tttttatttc ccgtcaatga cgaagaagat       180
     ttcgccaatg ctaaaaagca tgccgccgat tttctgattc aaatctgcgg gggaccggac       240
     tattttgccc aaacgcgcgg agagcctcgt atggtcgggc gtcatgcccc gttccgtatt       300
     gatgagcacg gccgccgccg atggctggag ttttatgccg aactcctccc tccgctcgaa       360
     gcggagggga ttaatcccga atatatccaa tccttttggg actacctcga catattttca       420
     atctggatga tcaatacccc ttcgcattaa                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page