(data stored in ACNUC7421 zone)

EMBL: CP002355.PE233

CP002355.PE233       Location/Qualifiers
FT   CDS_pept        complement(222738..224267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0234"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: abu:Abu_0069 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF3373)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32901"
FT                   /db_xref="InterPro:IPR021803"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXY8"
FT                   /protein_id="ADR32901.1"
FT                   /translation="MKQRILGSVITAALLTTNAFSDDSLIQRFEKMEREMAALKAELES
FT                   IKAENSRLSTQLSTPSNTNSKQDATTSANINETLEDIQDQISTINKKTNGDNLKFGVDF
FT                   RTSVDNLHYKMADGSTHKNDAVFSNRLWLNMGYAANKNISFTGQLAYNKIFGERAQTTQ
FT                   SPAMEGFDWISGESAYDDTLRVRSAYFLYTDDELAGLEIPWTFSIGRRPSTEGHLINFR
FT                   DDVKTSSPLAHAINVEFDGASAKFGTEELTGLAGSYFKLCAGRGMSEAEPRFSSAPYTG
FT                   NGSSKTNNIDMAGIIVVPYDDKQFSTGFQYTYANNLIDQEAPGGNMETVGGLHTATAFA
FT                   MVNGIGDGWSEFLDDSLIFISGAVSKTDPYKGSGKQGMLGSFDSETGYSYWIGTQFPSL
FT                   ISEEGRWGIEFNHGSSFWRPLTYGEDTLIGSKIAARGDAYEVYFTEPLVDDILTFQLRY
FT                   TYINYDYSGSNGFFGSVTGTPMSMDQAIGAGYGDNVVDKAQDIRAYLRYKF"
     atgaaacaac ggattttggg ctcagtcata accgccgcgt tacttaccac aaacgcattt        60
     tcggatgact cgcttataca gcggttcgaa aaaatggaac gtgagatggc ggcactaaaa       120
     gccgaacttg aatcgataaa agctgaaaac agccgtctaa gcactcaact ttcaacgcct       180
     tcgaatacca attcaaaaca agacgcgaca acgtctgcca atattaatga gacacttgaa       240
     gatattcaag accaaatcag cacgatcaat aaaaaaacaa acggcgacaa cctgaaattc       300
     ggggttgatt tccgcaccag tgtcgataac cttcactata aaatggcgga tggaagcaca       360
     cacaaaaacg atgccgtatt cagcaaccgc ctttggctga atatgggcta tgccgccaac       420
     aaaaacatca gttttaccgg gcagttagcc tataataaaa ttttcggcga acgtgcgcaa       480
     acaactcaaa gtccggcgat ggagggtttt gactggatta gcggcgaatc ggcgtatgat       540
     gacaccctgc gtgtccgctc ggcctatttc ctctatactg acgatgaact cgcaggtttg       600
     gaaattccgt ggacgtttag tatcggccgc cgcccctcta ccgaaggaca cctcatcaat       660
     ttccgcgacg atgtcaaaac ttcctctccg ctcgcccatg cgatcaatgt cgaatttgac       720
     ggagccagtg ccaaattcgg gacggaagaa cttaccggcc ttgcgggatc gtatttcaaa       780
     ctctgtgcag ggcgcggtat gagcgaagcg gaaccgagat ttagttctgc cccctacacc       840
     ggtaacggct cttccaaaac caataacatc gatatggccg gcattatcgt cgttccctat       900
     gatgacaaac aattcagtac cggctttcaa tacacctatg cgaataattt gatcgatcaa       960
     gaagctccgg gcgggaatat ggaaacggta ggcggacttc ataccgcaac ggcgtttgct      1020
     atggtcaacg ggatcgggga cggatggagc gaatttttgg atgattcgtt aattttcatc      1080
     agcggtgccg tgtccaaaac cgatccgtac aaagggagcg gaaaacaagg tatgttaggc      1140
     tcatttgaca gcgagacagg ttacagctac tggatcggaa cacagtttcc atccctcatc      1200
     agcgaagaag ggcgatgggg gatcgaattt aaccacggtt cctcgttctg gcgtcctctt      1260
     acctacggcg aagacacact gatcggttct aaaatcgctg cacgcggaga tgcgtatgaa      1320
     gtgtatttca ccgaaccttt agtggacgac atcctaacgt tccaactacg ctatacctat      1380
     atcaattatg attacagcgg aagcaacggc tttttcggaa gtgttacagg tacccctatg      1440
     agtatggatc aggctatcgg tgccggttac ggtgacaacg tcgtcgacaa agcacaagac      1500
     atccgcgctt atctgcgata taaattttaa                                       1530
//

If you have problems or comments...

PBIL Back to PBIL home page