(data stored in ACNUC7421 zone)

EMBL: CP002355.PE234

CP002355.PE234       Location/Qualifiers
FT   CDS_pept        224571..225347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0235"
FT                   /product="SSU ribosomal protein S2P"
FT                   /note="COGs: COG0052 Ribosomal protein S2; InterPro
FT                   IPR018130: IPR005706: IPR001865; KEGG: tdn:Suden_1802 30S
FT                   ribosomal protein S2; PFAM: ribosomal protein S2; SPTR: 30S
FT                   ribosomal protein S2; TIGRFAM: ribosomal protein S2; PFAM:
FT                   Ribosomal protein S2; TIGRFAM: ribosomal protein S2,
FT                   bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32902"
FT                   /db_xref="GOA:E4TXY9"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXY9"
FT                   /protein_id="ADR32902.1"
FT                   /translation="MVTMKDLLECGVHFGHQTRRWNPKMKKYIFGVRKNIYIIDLQKTL
FT                   RYFRNAYQQVVDAAAEGKTVLFVGTKKQARVAIRDAAVACGMPYVDNRWLGGMLTNFPT
FT                   IQKSIRKLDIIEEMQANGQINLLTKKEALMMNRQKEKLIAYLGGIRHMKTLPDMMFVID
FT                   AVKEHIAVQEARNLGIQVVAPLDTNCDPDVIDIPIPGNDDAIRSIQLFCKEMAEAINEG
FT                   KALRNGGNDEAVAEEEVAPEAAAVEAATEEVVAEEA"
     atggtaacta tgaaagacct tttggaatgc ggtgtacact ttggtcacca aacacgtcgt        60
     tggaatccga aaatgaaaaa atacattttc ggtgttcgta aaaacattta catcatcgat       120
     cttcaaaaaa cattgcgtta tttccgcaat gcgtatcaac aagttgttga tgctgcagct       180
     gaaggtaaaa ctgttctttt cgtaggaaca aaaaaacaag cacgtgttgc gatccgcgat       240
     gcggcagtag catgtggaat gccgtacgtt gacaaccgat ggttgggtgg aatgttgaca       300
     aacttcccga cgatccaaaa atcaatccgc aaacttgata tcatcgaaga gatgcaagca       360
     aacggacaaa tcaacctttt gactaaaaaa gaagcgttga tgatgaatcg tcaaaaagaa       420
     aaattgatcg catacctcgg cggtatccgt catatgaaaa ctttgccgga catgatgttt       480
     gttatcgatg cggtaaaaga acacatcgcg gttcaagaag cgcgtaacct cggaatccaa       540
     gttgttgctc cacttgatac taactgtgat cctgacgtta tcgatattcc aatccctgga       600
     aatgacgatg cgatccgttc tatccaactt ttctgtaaag aaatggcgga agcgatcaat       660
     gaaggtaaag cacttcgtaa cggcggaaac gacgaagcgg tagcggaaga agaagttgca       720
     cctgaagcag cagcggttga agcggctact gaagaagttg tagcagagga agcgtaa          777
//

If you have problems or comments...

PBIL Back to PBIL home page