(data stored in ACNUC7421 zone)

EMBL: CP002355.PE235

CP002355.PE235       Location/Qualifiers
FT   CDS_pept        225350..226417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0236"
FT                   /product="translation elongation factor Ts (EF-Ts)"
FT                   /note="COGs: COG0264 Translation elongation factor Ts;
FT                   InterPro IPR018101: IPR001816: IPR000449: IPR014039; KEGG:
FT                   tdn:Suden_1801 elongation factor Ts; PFAM: Translation
FT                   elongation factor EFTs/EF1B dimerisation;
FT                   ubiquitin-associated- domain-containing protein; SPTR:
FT                   Elongation factor Ts; TIGRFAM: translation elongation
FT                   factor Ts; PFAM: Elongation factor TS; UBA/TS-N domain;
FT                   TIGRFAM: translation elongation factor Ts"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32903"
FT                   /db_xref="GOA:E4TXZ0"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXZ0"
FT                   /protein_id="ADR32903.1"
FT                   /translation="MAEITAAMVKDLRTATDAPMMDCKKALTECDGDMEKAKDWLRDRG
FT                   MAQTAKKADRVAAEGLLGLKVSETFSSASLVEINSETDFVAKNDGFIALVGNTAAHVFT
FT                   TGVSTVEELNETSYETGTFSEYFTSQVARIGEKIVTRRFVTLNAGENGCVNGYVHSNGR
FT                   VGVLVAAACSDAKVAEAMAPMLKNVAMHAAAMKPTTLTSKDFDPAFVEAETIGRIEAIK
FT                   TENEELARLKKPLKNVPQYISACQLTPEVMAAAEEAIKAELAAEGKPEKIWANIIPGKL
FT                   ARFVADNTTLDKELALLDQNYVMDDSLTVAEAITKEAAKHGGTAELVEFVKYEVGEGIE
FT                   KQVNDFAAEVAAQMS"
     atggcagaaa tcacagcagc aatggtaaaa gaccttcgta cggcgacaga tgcgcctatg        60
     atggattgta aaaaagccct cactgagtgt gatggtgata tggaaaaagc gaaagattgg       120
     ttacgtgacc gcggtatggc ccaaacggct aagaaagcgg atcgtgttgc ggctgaagga       180
     cttttaggtc ttaaagtatc tgaaactttc tcttcggctt ctttggtaga gatcaactcg       240
     gaaactgact tcgttgctaa aaacgacggc ttcatcgctt tggtcggaaa cactgcggca       300
     cacgtattta caacgggtgt aagcacggta gaagagttga acgaaacttc atatgaaaca       360
     ggtacattct ctgagtattt cacatctcaa gtagcacgta tcggtgaaaa aatcgtaact       420
     cgccgttttg taactctcaa tgcgggtgaa aacggatgcg ttaacggtta cgttcactct       480
     aacggccgtg tcggtgttct tgtagcggct gcgtgttcgg atgcaaaagt agccgaagct       540
     atggctccta tgcttaaaaa cgttgcaatg cacgctgcgg cgatgaaacc tacgacattg       600
     acatctaaag atttcgatcc tgcgttcgtt gaagcggaaa ctatcggtcg tatcgaagcg       660
     atcaaaactg agaacgaaga attggcacgt ttgaaaaaac cgcttaaaaa cgttcctcaa       720
     tatatctctg cttgccaatt gactccggaa gttatggctg cagctgaaga agcgataaaa       780
     gctgaactcg cggcagaagg caaaccggaa aaaatctggg caaacatcat ccctggtaaa       840
     ttggctcgtt tcgtagcgga caatacgact ttggataaag agcttgcgct tttggatcaa       900
     aactacgtta tggatgattc tttgacagta gctgaagcga tcacaaaaga agcggcaaaa       960
     cacggcggaa cggctgaact tgtagagttc gttaagtacg aagtgggtga aggtatcgaa      1020
     aaacaagtca acgatttcgc tgccgaagtc gctgcacaaa tgagttaa                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page