(data stored in ACNUC7421 zone)

EMBL: CP002355.PE236

CP002355.PE236       Location/Qualifiers
FT   CDS_pept        226505..227146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0237"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1136 ABC-type antimicrobial peptide
FT                   transport system ATPase component; InterPro IPR017871:
FT                   IPR003439: IPR003593; KEGG: tdn:Suden_1799 ABC
FT                   transporter-related protein; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase; SPTR: Lipoprotein-releasing system
FT                   ATP-binding protein LolD; manually curated; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32904"
FT                   /db_xref="GOA:E4TXZ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXZ1"
FT                   /protein_id="ADR32904.1"
FT                   /translation="MTLLKATSLSHAFDYPLFEDISMTLNEGESIAIVGVSGSGKSTLM
FT                   HILSSLLHPLKGNVELFGEDIYRLDDKSLVKLRRNDLGMIYQSHYLFKGFSAYENLEVA
FT                   TLLSGEKIDPTLLKRLGIDHVINQKVTELSGGQQQRVSIARVMSKKPRLIFADEPTGNL
FT                   DHATALEVMEIFDDYLREHKAAMILVTHDEALAERCTHVYRMQNGSLKEM"
     atgacacttt taaaagctac ctctttatca catgcctttg actatccttt gtttgaggat        60
     atttccatga ctctcaatga gggagaatcg atcgccatag tcggtgtcag cgggagcgga       120
     aaatcgacac tgatgcacat tctctcttca ttgctgcatc ctctaaaagg gaatgtcgag       180
     cttttcggtg aggatattta ccggcttgac gataaatcgc ttgtgaagct tcgccgtaat       240
     gatttgggga tgatctatca aagccactac ctttttaagg gcttcagcgc gtatgaaaat       300
     ctggaagtgg caacgctcct ttccggtgag aaaattgatc cgacgctgct aaagcgtttg       360
     gggatcgatc acgtgatcaa ccaaaaagtg accgaactct ccggagggca gcagcaacgt       420
     gtatcgattg cccgtgtaat gtccaaaaaa ccgcgtctga tttttgcgga tgagccgaca       480
     gggaatcttg atcatgcgac ggcgcttgag gtaatggaaa ttttcgatga ctatttgcgc       540
     gagcataagg ccgcaatgat cttagtgacc cacgatgaag cgctggctga acgctgtaca       600
     catgtctatc gtatgcaaaa cggtagtttg aaagagatgt aa                          642
//

If you have problems or comments...

PBIL Back to PBIL home page