(data stored in ACNUC7421 zone)

EMBL: CP002355.PE237

CP002355.PE237       Location/Qualifiers
FT   CDS_pept        227151..227915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0238"
FT                   /product="flagellar biosynthetic protein FliR"
FT                   /note="COGs: COG1684 Flagellar biosynthesis pathway
FT                   component FliR; InterPro IPR006303: IPR002010; KEGG:
FT                   tdn:Suden_1798 flagellar biosynthesis protein FliR; PFAM:
FT                   type III secretion system inner membrane R protein; SPTR:
FT                   Flagellar biosynthetic protein fliR; TIGRFAM: flagellar
FT                   biosynthetic protein FliR; PFAM: Bacterial export proteins,
FT                   family 1; TIGRFAM: flagellar biosynthetic protein FliR"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32905"
FT                   /db_xref="GOA:E4TXZ2"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXZ2"
FT                   /protein_id="ADR32905.1"
FT                   /translation="MEWAEIFSEGRTIAFILLFIRFGALFMAVPIFSHMNIPISIKAAM
FT                   AFFFTVFFFGAVPPLHIPTDTLSLTVAILGEMLFGLAVGIVLQLAYHVITFAGGQISFM
FT                   MGFSLASAIDPQSGVSMPIISQFLSLLALMILLIFDLHHWILLYASQSISTVPLGGFLM
FT                   TPSLFKYIMHAMTNMFVVGFMIAFPITALSMLADLIFGMLMKTMPQFNLLVIGMPIKIA
FT                   VSFVVLMATLGATLMIVTSQTQNAYNFLEKLF"
     atggaatggg cagaaatttt tagcgaaggc cggaccatcg cttttatttt gctgttcatc        60
     cgcttcggtg ctttgttcat ggcagtaccg atattttcac atatgaatat tccgatatcg       120
     atcaaagcgg ctatggcttt tttctttacg gtcttttttt tcggtgccgt tccgccgcta       180
     catatcccta ccgataccct tagtctcacc gttgcgattt tgggtgaaat gcttttcggc       240
     cttgccgtcg gaatcgtatt gcagctggcc tatcatgtga tcacatttgc aggggggcaa       300
     atatcgttta tgatgggatt ctcgcttgct tcggcgattg atccgcaatc tggggtttcg       360
     atgccgatta tcagtcagtt tttatcgttg ctggcattaa tgatattact gatctttgat       420
     ttgcatcatt ggatattgtt atatgcatca cagtcgatca gtaccgttcc tttgggagga       480
     tttctgatga ccccgtcact gtttaaatac attatgcatg caatgacaaa catgtttgtc       540
     gtcgggttca tgatcgcatt tccgattacg gcgctatcca tgctggcaga tttaattttc       600
     ggaatgctga tgaaaacgat gccgcaattc aacctattgg tcatcggtat gccgattaaa       660
     atcgccgttt cgtttgtagt ccttatggct acattggggg caaccttgat gatcgttacc       720
     tcacaaaccc aaaatgccta taattttctc gaaaagctat tctaa                       765
//

If you have problems or comments...

PBIL Back to PBIL home page