(data stored in ACNUC7421 zone)

EMBL: CP002355.PE238

CP002355.PE238       Location/Qualifiers
FT   CDS_pept        complement(227907..228383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0239"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nis:NIS_1499 nuclease NucT; SPTR: Membrane
FT                   bound endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32906"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXZ3"
FT                   /protein_id="ADR32906.1"
FT                   /translation="MIKLLVLLFIFVSVYAQETIFKLPDNHSRFLHQLDRSFKTASQIL
FT                   IITPSLHHSDLSKKLLSAIKKGTTVTLTVQETKGDPLSLIQYKNIELYLSEVKLDQTLI
FT                   LVDDSLVCTSDGTINEELFRSAHSVIRCSDNPNKIRSIRNASYPFIQHARPYLE"
     atgataaaac ttcttgtgct tcttttcata tttgtatccg tttatgcaca agaaactatt        60
     tttaaactgc ccgataatca cagccgtttt ctgcatcaat tggatcgctc gtttaaaact       120
     gcttcacaaa ttcttatcat aaccccctct ttgcaccatt cagatttaag taaaaaactt       180
     ctctcggcaa tcaaaaaagg gactacggtg acattaaccg tccaagagac aaagggagac       240
     cctctttctc tgatccagta taaaaatata gaactgtatc tctctgaagt gaagctggat       300
     caaacgctca tcctagtaga tgattctttg gtatgtacaa gcgatggtac tattaatgaa       360
     gagttatttc gttcggctca ctccgtcatt cgatgcagcg ataatccaaa caaaatccgt       420
     tcgatccgaa atgcttccta tccttttatt caacacgcca gaccttattt agaatag          477
//

If you have problems or comments...

PBIL Back to PBIL home page