(data stored in ACNUC7421 zone)

EMBL: CP002355.PE239

CP002355.PE239       Location/Qualifiers
FT   CDS_pept        228463..229947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0240"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1797 hypothetical protein; SPTR: DNA
FT                   topoisomerase IV subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32907"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXZ4"
FT                   /protein_id="ADR32907.1"
FT                   /translation="MKILLFNDNPVVRKLVALSAQKTKDDLSVVWSTDEIEGNEYDLLI
FT                   VDDALYSDEILDSINEKIVAKNTLFMATRGKAVPSGFDNVINKPFLPTDLVDMFVQIEK
FT                   KVSVGRDQSDNEVEEHASSTSTYAINLEDSLSELEGDETEALVGAEDDLDFGDLDDYED
FT                   KLPETAILDQEEVQEVQELLEDTEEDDLTMDDEFSVEGSAPISLPDEEIGVPIELEDDF
FT                   SLDDANIIDEEKEEEELLGFDDIEENEIPSDEEVPKNDLSEDDEFGDLELPEPLEESSG
FT                   LSDEDELLSMGEDDALGELELPEDDGLSDMNDATSFDLSGLEEMDESMLMDDDELGDLE
FT                   SKIEDAVGGLESEELERELETDDFDLSLNDEMMEELMSTEEENLMDTGSFDELDMLDER
FT                   ELKIAVGEEVEEEDEPVLVAKGGSSLAAEALDEVLNESSPYAEFTDEIEEAEPVASHAE
FT                   GVEALQALLKALSNENVSKSLKGMNISININFGNGA"
     atgaaaattt tgctttttaa cgataatccg gtagttcgaa agctggttgc tctcagcgcg        60
     caaaaaacaa aagatgattt gagtgtagtc tggtcaacag acgaaattga ggggaatgaa       120
     tacgatttgc tcattgtcga tgatgcattg tacagtgatg agatattgga ttccatcaat       180
     gaaaaaattg ttgctaaaaa cacgttattt atggctacac gaggcaaagc cgtcccttcc       240
     gggtttgata atgttattaa taagccgttc ttgcctaccg atttggtgga tatgtttgtt       300
     caaattgaaa aaaaagtgag tgttgggcgt gatcagtcgg ataatgaagt tgaagagcat       360
     gcttcaagta cttcgacata tgcgataaat ttggaagatt ccctttcaga actagagggc       420
     gatgaaactg aagcgttagt cggagcggaa gacgatttag attttggcga cttggacgat       480
     tatgaggaca aattgcctga aaccgctatt ttggatcagg aagaggtaca ggaagttcaa       540
     gaacttttag aggataccga agaagatgat ctgactatgg atgacgagtt ttcggtagaa       600
     ggaagcgctc cgatcagtct ccctgatgag gagatcggag taccgataga gttggaagat       660
     gatttctctt tagatgatgc aaatattatt gatgaggaaa aagaggaaga agaactctta       720
     ggctttgatg atatagaaga gaatgaaata cctagtgatg aagaagtgcc gaaaaatgat       780
     ctttcagagg acgatgagtt cggcgatctt gagcttcctg aaccattaga agaaagcagc       840
     ggattatcag acgaagatga acttttgtca atgggtgaag acgatgcact tggtgaatta       900
     gaattgcctg aagatgatgg gctgtcggac atgaatgacg caacttcttt tgatctctcg       960
     ggattggaag agatggatga gtctatgctt atggatgatg atgaactggg tgatttagaa      1020
     tcaaagattg aagatgccgt tggcggatta gaaagcgaag aattggaacg agaattggaa      1080
     acagatgatt ttgaccttag tttgaatgat gagatgatgg aagaattgat gtcgacagaa      1140
     gaagagaacc tgatggatac ggggagtttt gatgagttgg acatgcttga cgagcgggaa      1200
     cttaaaatag cggtaggtga agaggtagaa gaagaggatg aacctgtttt ggttgcaaaa      1260
     gggggatcat cacttgcggc tgaggcgctg gatgaagtat tgaacgaatc atcaccgtac      1320
     gcagaattta ctgatgaaat tgaggaagcc gagccagttg cctcacatgc agagggcgtt      1380
     gaagcgctac aggcacttct taaagcgtta tcgaatgaaa acgtctccaa atccctcaaa      1440
     gggatgaata tcagtattaa catcaatttc gggaacggtg catga                      1485
//

If you have problems or comments...

PBIL Back to PBIL home page