(data stored in ACNUC7421 zone)

EMBL: CP002355.PE24

CP002355.PE24        Location/Qualifiers
FT   CDS_pept        complement(26406..27269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0024"
FT                   /product="cobalamin biosynthesis protein CobD"
FT                   /note="COGs: COG1270 Cobalamin biosynthesis protein
FT                   CobD/CbiB; InterPro IPR004485; KEGG: ant:Arnit_1844
FT                   cobalamin biosynthesis protein CobD; PFAM: cobalamin
FT                   biosynthesis protein CbiB; SPTR: Cobalamin biosynthesis
FT                   protein CobD; TIGRFAM: cobalamin biosynthesis protein CobD;
FT                   PFAM: CobD/Cbib protein; TIGRFAM: cobalamin biosynthesis
FT                   protein CobD"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32692"
FT                   /db_xref="GOA:E4TW76"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW76"
FT                   /protein_id="ADR32692.1"
FT                   /translation="MFFGVALIAYITDRLFGEFPFIRHPIVLMGDFITAFQKRFYRDSI
FT                   LRGFWLVFWLLAAVLAIVTPITLIGNPWILGIIASTGIAGKMLYESVNNVLSDPSSIRY
FT                   LVSRDTQNLSESEINKAAIETYAENLSDGVIAPLFYLLVFGLVGLFLYKAVNTLDSMVG
FT                   YRNERYEKFGKVSARLDDLLNYLPSRITAVIILTFFGKLSALKKTWHYGAQHESPNAGY
FT                   PIAAMALSLYVSLGGPTSYFGTIKNKPYFGEGKREITDGDVRSALALQWKLDTLVILLL
FT                   AAGVYA"
     atgttctttg gagtagctct aatagcttac atcaccgacc gcctctttgg tgagttcccc        60
     tttatccgcc accccattgt cctcatgggc gatttcatca ctgcgtttca aaagaggttc       120
     tatcgtgaca gtatcctgcg cggattttgg ctcgtgtttt ggctgttagc cgcagtgtta       180
     gccatcgtca ctccgatcac cttgatcggc aacccgtgga tattggggat catcgcctcg       240
     acggggatcg cggggaagat gctctacgag agtgtgaaca acgtcctgag tgacccttct       300
     agcatccgct accttgtgag ccgcgacacc caaaacctga gcgagagcga gatcaacaag       360
     gccgcgatcg agacctacgc cgaaaatctg agcgatgggg tgatcgcccc gctattttat       420
     ctgttagtgt ttggtttggt gggactgttt ctctataaag cggtcaatac cctcgattcg       480
     atggtgggat accgcaacga gcgctacgag aaattcggca aggtgagcgc ccgtttggac       540
     gatctcctca attacctccc ctcccgtatt acggcggtga tcatcctcac ctttttcggc       600
     aagctcagcg ccctcaaaaa gacatggcat tacggcgcac agcatgaaag ccccaatgcg       660
     ggatatccga tcgcggcgat ggcactctcg ctctatgtgt cgctcggggg gccgacgtcg       720
     tatttcggca cgatcaaaaa caagccctat ttcggcgagg ggaagcggga gatcaccgac       780
     ggcgatgtcc gaagcgcatt ggctcttcag tggaaactcg atacccttgt gatactactt       840
     ttggcggcgg gggtttacgc atga                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page