(data stored in ACNUC7421 zone)

EMBL: CP002355.PE240

CP002355.PE240       Location/Qualifiers
FT   CDS_pept        229944..230564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0241"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="COGs: COG0194 Guanylate kinase; InterPro IPR020590:
FT                   IPR017665: IPR008144: IPR008145; KEGG: tdn:Suden_1796
FT                   guanylate kinase; PFAM: guanylate kinase; PRIAM: Guanylate
FT                   kinase; SMART: guanylate kinase/L-type calcium channel
FT                   region; SPTR: Guanylate kinase; TIGRFAM: guanylate kinase;
FT                   PFAM: Guanylate kinase; TIGRFAM: guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32908"
FT                   /db_xref="GOA:E4TXZ5"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXZ5"
FT                   /protein_id="ADR32908.1"
FT                   /translation="MNRQSGAILVLSGPSGAGKSSLIQKIKDQIGPIYFSISTTTRPIR
FT                   EGEVDGVHYYFVGVEEFKRDIEDEMFLEYAVVHGNYYGTSLGPVKKALKEGKLVIFDID
FT                   VQGHDAVQNRLSDITTSVFITTPSLEELKRRLYNRSTDSEEVILGRIEMAKREVQRISE
FT                   YDFLIVNDNLEEAAEILVSIAKAARMKIPTFQINEFVQTWEAS"
     atgaatcgtc aaagcggagc gatactcgtt ttatcagggc caagcggcgc cggcaaaagt        60
     tcattgattc agaaaattaa agatcagatc ggtccaatct atttttcgat ttcaacgacg       120
     acacgcccta tccgagaagg tgaagtggac ggtgttcact attatttcgt gggtgtagaa       180
     gagtttaagc gcgatataga agatgagatg tttttggaat atgcagtcgt tcacggcaat       240
     tattacggaa catcgttagg accggttaaa aaagcgctta aagaaggaaa actcgttatt       300
     tttgatatcg acgtgcaggg gcacgacgcg gtacaaaatc ggctaagcga cattacaaca       360
     tcggtcttta ttaccacccc ttcactggaa gagttaaaac gacggttgta taaccgttct       420
     accgacagcg aagaggtcat cctcggacgt attgaaatgg caaaacggga agttcagcgg       480
     attagcgaat atgatttttt aatcgtcaat gacaaccttg aagaagcggc ggaaattttg       540
     gtttccatag caaaagcggc acggatgaag ataccgacat ttcaaattaa tgaatttgtt       600
     caaacctggg aagcctcgta a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page