(data stored in ACNUC7421 zone)

EMBL: CP002355.PE242

CP002355.PE242       Location/Qualifiers
FT   CDS_pept        230877..232457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0243"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="COGs: COG0018 Arginyl-tRNA synthetase;
FT                   InterProIPR001412: IPR001278: IPR015945: IPR005148: IPR
FT                   008909; KEGG: tdn:Suden_1794 arginyl-tRNA synthetase; PFAM:
FT                   Arginyl-tRNA synthetase, class Ic, core; arginyl tRNA
FT                   synthetase domain protein; DALR anticodon binding domain
FT                   protein; PRIAM: Arginine--tRNA ligase; SPTR: Arginyl-tRNA
FT                   synthetase; TIGRFAM: arginyl-tRNA synthetase; PFAM: DALR
FT                   anticodon binding domain; Arginyl tRNA synthetase N
FT                   terminal domain; tRNA synthetases class I (R); TIGRFAM:
FT                   arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32910"
FT                   /db_xref="GOA:E4TXZ7"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXZ7"
FT                   /protein_id="ADR32910.1"
FT                   /translation="MKQRVNALLRDKFNADVILEKPKDRSFGHFATPIAFSLAKELRKS
FT                   PMLIAEEIAGSFADESMFSAVESVQGYINFRLSEAFLDEYASWALSHGDEFGSSDKKGT
FT                   ILLEFVSANPTGPLHIGHARGAVYGDTMLRLGRHLGYDITAEYYVNDAGNQIDLLGVSL
FT                   QLEGRSSLLGESVEWPEKYYRGEYLSDLAREVVELFGEEALRDESRQKELALWAKDKIL
FT                   ALIVDDLAAINVHFDTFVGEASLYSEWDRVMAKMGEGVYVNEGKTFIRSSDLGDDHDRV
FT                   VVREDGRPTYLAGDIIYHNQKFERGYDDYINIWGADHHGYIARVKAAITFLGYDSSKLE
FT                   VLLSQMVSLLKDGEPFKMSKRAGTVILMSDVVEEIGAEALRFMFASKKCDTALEFDIEE
FT                   LKRQDSSNPIYYIQYAHARIQTLISKSEKNMDEIMGSHLYGLSSDADGLLFEALLLPEI
FT                   IDDAFESRQAQKLPDYLKVLAGRLHKFYYDTRIIGTEDEAKLLKLLLVVALSIKTGLSL
FT                   LGIQAKDRM"
     ttgaaacagc gagtcaatgc gctgttgcgc gataaattca atgctgacgt tatcctcgaa        60
     aaaccgaaag atcgttcttt cggtcacttc gctaccccta tcgctttttc actagccaaa       120
     gaattacgaa aatctcctat gctcattgcc gaagagattg cagggtcgtt cgcggatgag       180
     tcgatgttta gtgccgtaga atcggttcag ggctatatta attttcgtct ctccgaagca       240
     tttttggatg agtatgcttc atgggcattg agccacggcg atgaatttgg aagcagcgat       300
     aaaaaaggga cgatcctttt ggaattcgta agtgccaacc cgacgggacc gcttcacatc       360
     ggtcatgccc gcggtgcggt gtacggcgat acgatgctgc gtctcgggcg tcatttaggc       420
     tacgatatca cggcggaata ctacgttaac gatgcgggaa atcagatcga tttactcggt       480
     gtctcccttc agcttgaagg gcgaagcagt ctcctcggcg agagtgtcga atggcctgag       540
     aaatattacc ggggcgagta tctgagcgat ttggcacgag aagttgtaga gcttttcggc       600
     gaagaagctc tgcgtgatga gagccgtcaa aaagaactgg cattgtgggc aaaagacaaa       660
     attttggccc ttatcgtaga tgatctggcc gcgatcaatg tccactttga tacatttgtc       720
     ggagaagcat cgctgtacag cgaatgggac cgtgtcatgg caaaaatggg cgagggtgtt       780
     tatgtgaatg aaggcaaaac ctttatccgc tcatccgacc tcggcgatga ccacgatcgg       840
     gtcgttgtcc gtgaagacgg ccgacctacc taccttgctg gggatattat ctaccataac       900
     caaaagttcg agcgcggata tgatgattat atcaatatct ggggagcgga tcaccacggt       960
     tatatcgccc gtgtgaaagc ggcaattacc tttttgggct acgattcttc caagctggaa      1020
     gtactccttt cgcagatggt gagtcttctt aaagacggtg aaccgtttaa gatgtccaaa      1080
     cgtgccggaa ctgttatttt gatgagcgat gtcgtcgaag agatcggtgc ggaagcgctg      1140
     cgctttatgt tcgcctctaa aaagtgcgac acggcgctcg agttcgatat cgaagaactc      1200
     aaacgtcagg acagttccaa cccgatctac tatatccaat atgcgcatgc ccgtattcag      1260
     acattgattt caaaaagcga aaaaaatatg gatgagatta tgggatcaca tttgtatgga      1320
     ctgagtagcg atgccgacgg attgttgttt gaagcgctgt tgttaccaga aatcatcgat      1380
     gacgctttcg aatcgcgcca agcgcaaaag cttcctgact atcttaaagt tttagcggga      1440
     agattgcata aattttatta cgatacccgt attatcggaa cggaagacga agcaaaactt      1500
     cttaaacttc ttcttgtcgt tgctctctct atcaaaacag ggctctcatt gctcggaatc      1560
     caagcaaaag accggatgta a                                                1581
//

If you have problems or comments...

PBIL Back to PBIL home page