(data stored in ACNUC7421 zone)

EMBL: CP002355.PE243

CP002355.PE243       Location/Qualifiers
FT   CDS_pept        complement(232506..233252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0244"
FT                   /product="flagellin domain protein"
FT                   /note="InterPro IPR001492: IPR001029; KEGG:
FT                   cff:CFF8240_0520 flagellin; PFAM: flagellin domain protein;
FT                   SPTR: Flagellin; PFAM: Bacterial flagellin N-terminal
FT                   helical region; Bacterial flagellin C-terminal helical
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32911"
FT                   /db_xref="GOA:E4TXZ8"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXZ8"
FT                   /protein_id="ADR32911.1"
FT                   /translation="MKVNSLSNALPQMNTETSNRDKTLEKIATAVELKLEDSSSRTIAD
FT                   MMQNQISSLSQGLMNANDGIAMLQIADGALSSLSDQTQTLNDLSVRNNSAILNSADKQA
FT                   LNSQFQRTLSSMQNIVNTTSYNGNPLFNNNFSISIGEGTLSASIANVSPKGLSIDNQEG
FT                   INQYAQTLASAQSDVGSATNNFISSTNVLLQQITDTAAAKSQIADTDMAKQVSEFQQSN
FT                   NQISAGLLAMAHQTDTMRQSMARLLG"
     atgaaagtaa attcactatc aaatgcgctt ccgcagatga atacggaaac ttcaaatcgt        60
     gataaaacgc ttgagaaaat cgctacagcc gttgaactca aattagaaga cagttcgtca       120
     cggactattg ccgatatgat gcagaatcaa atttcttcat tatcgcaggg gttaatgaac       180
     gccaatgacg gaattgccat gttgcagatt gctgacgggg cactgagcag cctttcggat       240
     cagacacaaa cattgaacga tttaagtgtc cgcaataaca gcgctatcct caacagtgcc       300
     gataagcaag cgttaaacag tcagtttcag cgtaccctct catcgatgca aaacattgtt       360
     aacacgacaa gctacaacgg caatcctctt tttaacaaca atttttctat ctcgatcggt       420
     gagggcaccc tttcggcatc tattgcgaat gtttctccga aagggctgag tattgataac       480
     caagaaggga tcaaccaata tgcccaaacg cttgcatcag cccaaagcga tgtcggatcg       540
     gcaaccaaca attttatcag cagtacaaat gtactgttgc agcaaataac cgatacggcg       600
     gcagcgaaaa gccaaatcgc ggatacggat atggcaaaac aagtgagtga gtttcagcaa       660
     agcaataatc agatcagtgc aggcttgctt gcgatggcac accaaacgga cacaatgcgt       720
     caatcgatgg cacgcctttt aggctaa                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page