(data stored in ACNUC7421 zone)

EMBL: CP002355.PE245

CP002355.PE245       Location/Qualifiers
FT   CDS_pept        234248..234928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0246"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterPro IPR001789: IPR001867; KEGG: abu:Abu_1762
FT                   two-component response regulator; PFAM: response regulator
FT                   receiver; transcriptional regulator domain-containing
FT                   protein; SMART: response regulator receiver; SPTR:
FT                   Two-component response regulator; PFAM: Response regulator
FT                   receiver domain; Transcriptional regulatory protein, C
FT                   terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32913"
FT                   /db_xref="GOA:E4TY00"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY00"
FT                   /protein_id="ADR32913.1"
FT                   /translation="MEKSATKNLHVLYVEDDDVARENGIEYLENYFDHVHAASDAFEGL
FT                   KLYREVHPEIIITDIQMPKLNGLEFIKQIRKENKETQIIVISAYSDTTYLLQAIELQLV
FT                   KYLIKPVQESAFKEALRQCIESIHHKDSNIINLPENTYFDTYNQTLVRDGDIVALRTKE
FT                   LQILSLLLKYKNRYVTYSEIENHVWRESAMSNDALKTLMKNLKAKLPPNLISNLSGTGY
FT                   KIEC"
     atggaaaaat cagccacaaa aaatcttcat gttttatatg tagaagatga tgatgtggca        60
     cgtgaaaacg ggattgaata ccttgaaaac tacttcgatc atgttcatgc cgcttcggat       120
     gcttttgaag gattaaagct ctatcgggag gttcatcccg aaatcatcat taccgatatt       180
     cagatgccta aactaaacgg cttagagttt atcaaacaaa tccgtaaaga gaataaagag       240
     acgcagatta ttgtcattag cgcgtacagt gacacaacct atcttcttca ggcaatcgag       300
     ttgcagttag tcaaatacct gattaaaccg gtacaggaga gcgcttttaa agaagcgttg       360
     cgacaatgta tcgaaagtat ccaccataaa gattctaata tcatcaacct tccggaaaat       420
     acctattttg acacgtacaa tcagactctt gtccgcgatg gtgacattgt tgctttacgg       480
     acaaaagagc ttcagatact gagtctgctc ctcaaataca aaaaccgcta tgtcacctat       540
     agcgagatcg aaaaccatgt ttggcgagag agtgcgatga gcaatgacgc gcttaaaacc       600
     ctgatgaaaa atctcaaagc caaacttcct ccaaatctta tttcaaacct ctcggggacg       660
     ggatataaaa ttgagtgctg a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page