(data stored in ACNUC7421 zone)

EMBL: CP002355.PE246

CP002355.PE246       Location/Qualifiers
FT   CDS_pept        234918..236237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0247"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="COGs: COG4191 Signal transduction histidine kinase
FT                   regulating C4-dicarboxylate transport system; InterPro
FT                   IPR004358: IPR005467: IPR003594; KEGG: abu:Abu_1761
FT                   two-component sensor histidine kinase; PFAM: ATP-binding
FT                   region ATPase domain protein; SMART: ATP-binding region
FT                   ATPase domain protein; SPTR: Two-component sensor histidine
FT                   kinase; PFAM: 7TM diverse intracellular signalling;
FT                   Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32914"
FT                   /db_xref="GOA:E4TY01"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011623"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY01"
FT                   /protein_id="ADR32914.1"
FT                   /translation="MSAEAFTHLAYGATFGILLMSIVYTLVRYVYSKEIMYISYCAMQV
FT                   FSLGYISVYSHLFSLSAFSQEIFLLLATLSAVIFAITFHEGNLIPKITNFKELVINTLL
FT                   LNVVILTAFYHYILFEYLPYTVVYAILFLSIVFNLRSGFKPTIVYVIGWSLLCILLFVF
FT                   QLKQVYVEHGYIDIVLAAFAVEAVLFTISISYKYNLFKNQALDHQNMLFQQSKMAKSGE
FT                   MIANITHQFRQPLNNLSYLLMNLKSRYENRTLDDAYFDKKIASAQEQLQFLSKTIDDFK
FT                   EFYTPDKVKEPFSLTEAIRNSVAVIAPDLKSKGIVLEVVACDEEVIVFGKKNELSQVLL
FT                   ALISNASDALRGVSEPKIILRSNRNGSEAMIRLEDNGSGIPSDVLGKIFEPYVTTKSQG
FT                   SGIGLYLCKMIIEKSFGGKIEVESKVREGSVFTLSMALYH"
     ttgagtgctg aagcgttcac ccacttagcc tacggtgcaa cgttcggcat tttactgatg        60
     agtatcgtct atacgttggt acgctatgtt tattccaaag agattatgta tatcagctat       120
     tgtgcaatgc aggtcttttc attggggtac atcagtgtat acagtcatct tttttcgcta       180
     tcagcgttta gtcaagagat atttcttctg ctagcaacgc ttagtgccgt tatttttgcg       240
     ataacgtttc atgagggcaa tttgatccca aagattacta attttaaaga gttggttatc       300
     aataccctct tgctcaatgt tgtcatttta accgcctttt atcactatat cctttttgag       360
     tatctcccct atacggtagt ttatgcgatt ttgtttctct caatcgtatt taacctccga       420
     tcaggattta aaccgacgat cgtttacgtc atcggatggt cactgctgtg tattttgttg       480
     tttgtgtttc agctcaaaca ggtgtacgta gaacacggtt atatcgatat tgtattggcg       540
     gcgtttgcag tggaagcggt gttgtttacg atctctattt cgtacaaata caatcttttc       600
     aaaaatcagg cactcgatca tcaaaatatg ctgtttcaac agtcaaaaat ggcaaaaagc       660
     ggtgagatga tcgctaatat cacccaccag tttcgtcaac ccctcaacaa cctctcctac       720
     ctgttgatga atttgaaaag tcgatatgaa aaccgtacgc ttgacgatgc atattttgat       780
     aagaaaatcg cttcggctca ggaacaactg cagtttttat ccaagacgat tgatgatttc       840
     aaagagtttt atacccctga caaagtgaaa gaaccttttt ccctcaccga agcgatccgc       900
     aacagcgttg ccgtcattgc tcccgatttg aagagcaagg gaattgtatt ggaggttgtt       960
     gcttgtgatg aagaggtaat tgtttttggg aaaaagaatg agctgtcaca ggtacttttg      1020
     gcgttgatct ccaatgcgtc ggatgcattg agaggggtta gtgaaccaaa gattatcctt      1080
     cgcagcaacc gtaatggaag cgaagcaatg attagactcg aagataacgg gagcgggatc      1140
     ccaagcgatg tgctcggaaa gatatttgag ccctatgtta cgacaaaatc gcaagggagc      1200
     ggaatcgggc tctatttatg caaaatgata atcgaaaaaa gcttcggagg aaaaatagag      1260
     gtagagagca aggttcggga ggggagcgtg tttaccctct cgatggcgct ctatcactga      1320
//

If you have problems or comments...

PBIL Back to PBIL home page