(data stored in ACNUC7421 zone)

EMBL: CP002355.PE247

CP002355.PE247       Location/Qualifiers
FT   CDS_pept        complement(236231..237559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0248"
FT                   /product="cytochrome c oxidase accessory protein CcoG"
FT                   /note="COGs: COG0348 Polyferredoxin; InterPro IPR017900:
FT                   IPR014116: IPR017896; KEGG: abu:Abu_1760 ferredoxin-like
FT                   protein; SPTR: Ferredoxin-like protein; TIGRFAM: cytochrome
FT                   c oxidase accessory protein CcoG; PFAM: Ubp3 associated
FT                   protein Bre5; TIGRFAM: cytochrome c oxidase accessory
FT                   protein FixG"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32915"
FT                   /db_xref="GOA:E4TY02"
FT                   /db_xref="InterPro:IPR014116"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR032879"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY02"
FT                   /protein_id="ADR32915.1"
FT                   /translation="MSYATKRYWFYAFVTLFTFVVPFITLNENHLLLLSFEKLQFHFMG
FT                   LAYDVNEFYIMPFLLMFLFIGIFALTSILGRAWCGWGCPQTIFRTIYRDLIQGTLLDLR
FT                   NNANKQKRMDTSPLENKLKIVVGFLLWTLIATTASTNFIWYFVPPEDFFTYMYHPEEHL
FT                   FIIIFIATTAAFLIYDIVWMQESFCTYLCPYSRIQTVLYDDNTKHVVYNHNRGGLIYQN
FT                   NQKQITDSKQWIGTEECTTCEACVKVCPTHIDIRQGLQLECINCLGCADACTAVMGKLG
FT                   KKSLIEWGSQKSIFHDIKCSIFSKRNMMYFVAMAGSLIFAAAFASEQERVLVNINKPNE
FT                   LYKVQEGIVSNNYIVNIHNTQKQTYTYDVKVEDKNFRIDSFEALTLKPDGMRKRILVIS
FT                   TNQNLSQSDRRDTALKVKLMIFAKEDPKISVVKEISFIYPRTQ"
     atgtcttatg cgactaagcg atattggttc tacgcctttg tcaccctgtt tacctttgtt        60
     gtgccgttta tcacgctcaa tgaaaaccat ctgttacttc tctcgtttga gaaactccag       120
     ttccatttta tgggattggc atacgatgtc aacgaatttt acattatgcc gtttttgcta       180
     atgtttttgt ttatcggcat ttttgccctc acctccatct tgggtagagc gtggtgcgga       240
     tggggatgcc ctcagactat ttttcgaacc atttatcggg atctgattca aggaacactc       300
     cttgatttga gaaacaatgc gaacaaacaa aagcggatgg atacctcacc tcttgagaat       360
     aaactcaaaa ttgttgtcgg atttttgctc tggacgttaa tcgccacaac cgcatcgacc       420
     aatttcatct ggtattttgt tccgcctgaa gattttttca cctacatgta ccatcccgaa       480
     gaacacctat ttatcattat ctttattgcg acgactgcag catttttgat ctacgatatt       540
     gtatggatgc aggagagttt ttgtacctac ctgtgccctt attcacgtat tcaaaccgtc       600
     ctgtacgatg ataataccaa acacgtcgtc tataaccaca atcgcggcgg tttgatttac       660
     caaaacaatc aaaagcagat tacggatagt aaacagtgga taggaacaga agagtgtacc       720
     acctgtgaag cctgtgtcaa agtatgtccg acccacattg atatacgtca aggactacag       780
     ttagagtgta tcaactgcct cggatgcgcc gatgcctgta ctgctgttat gggcaaactg       840
     ggtaaaaaat cactgatcga gtggggaagc caaaaatcta tttttcatga cataaagtgc       900
     tctatttttt caaaacgcaa tatgatgtat ttcgtcgcta tggctggatc tttgattttt       960
     gcggcagcat ttgcatcgga acaagagcgg gtgttggtca atatcaataa accaaacgaa      1020
     ctctacaaag tgcaggaggg tatcgtgagc aacaactata ttgttaacat tcacaacacc      1080
     caaaaacaaa cctataccta tgatgtcaaa gtggaagata aaaacttccg tatcgatagc      1140
     tttgaagcgc taaccctcaa accggacgga atgcgaaaac ggatattggt gatctcgaca      1200
     aatcaaaact tgtcccagtc ggatcgaaga gacaccgcgt tgaaagtcaa actgatgatc      1260
     tttgcaaaag aagatccgaa aatctctgtc gtaaaagaga tttcgtttat ctatccgcga      1320
     actcagtga                                                              1329
//

If you have problems or comments...

PBIL Back to PBIL home page