(data stored in ACNUC7421 zone)

EMBL: CP002355.PE248

CP002355.PE248       Location/Qualifiers
FT   CDS_pept        237684..238472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0249"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="InterPro IPR001623; KEGG: tdn:Suden_1842 heat shock
FT                   protein DnaJ-like; PFAM: heat shock protein DnaJ domain
FT                   protein; SMART: heat shock protein DnaJ domain protein;
FT                   SPTR: DnaJ domain protein; PFAM: DnaJ domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32916"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY03"
FT                   /protein_id="ADR32916.1"
FT                   /translation="MKVVLRNNAIFVQGSSNTLEESWMEEFFDHHIHNTLFLDNGVLVL
FT                   NNENSSDQKEEFLETLSERFTKANELTSSFYSRSLKRCRTAAVRIEVPFRESEKVDIEV
FT                   YAYNSGCVQFTLLSPNRWVMRYLKQQLSNLVTSSTDDDIFIDVSTAAAKARLEKTLNRR
FT                   EVLHFTINYQYDDEFMSRLYGNYKGWGFGNDAIDKMIRYHAIFEIPMGSTPEDLKKRYR
FT                   MLAKRYHPDRVQSKNPKIINKYTEKFQLLQEAYGALRAVS"
     gtgaaagttg ttttacgcaa taacgctatc tttgttcaag ggagctctaa tacgctcgaa        60
     gagtcgtgga tggaggagtt tttcgaccat cacatccata acacactgtt tttggataac       120
     ggtgttctgg tcctcaacaa cgaaaattct tccgatcaaa aagaggagtt tttggagaca       180
     ttgagcgagc gttttacaaa agccaatgaa ctgaccagtt cgttttacag ccgatcgctc       240
     aaacggtgcc gcacggccgc cgtccggatt gaagttcctt tccgtgagag tgaaaaagtg       300
     gatatcgaag tatatgccta caattcgggt tgtgtacaat ttaccctttt gagtccgaac       360
     cgctgggtga tgcgctatct caaacagcag ctttccaatt tagtgacaag ctcgacagac       420
     gatgatattt ttatcgatgt cagtaccgct gccgctaaag cacgccttga gaaaacgctt       480
     aaccgccgag aagttctcca ttttacgatc aactaccaat acgatgacga atttatgagc       540
     cggctttacg gaaactacaa agggtgggga ttcggaaacg atgcaatcga taaaatgatc       600
     cgctaccatg cgattttcga aataccgatg ggatccacac cggaagattt gaaaaaacgg       660
     taccgaatgc tggcaaaacg gtatcacccg gatcgagtac agagcaaaaa tcctaaaatc       720
     atcaataaat acaccgaaaa attccagctt ctccaagagg cgtacggcgc attacgggcg       780
     gtcagttaa                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page