(data stored in ACNUC7421 zone)

EMBL: CP002355.PE250

CP002355.PE250       Location/Qualifiers
FT   CDS_pept        complement(239415..239744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0251"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecb:100060083 similar to tetratricopeptide
FT                   repeat domain 6; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32918"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY05"
FT                   /protein_id="ADR32918.1"
FT                   /translation="MLNTIREAQKQFQLLHQLLNLPMNRDTEYFTQLSIESEEAYVLMN
FT                   AGMCINTSVCRECAEHRDFIRSILEILSELEINASAANTYAAKLNEYSERVSKILKNIA
FT                   VVLAS"
     gtgttaaata ctatccgtga agcacaaaaa caatttcaac tacttcatca gctgctcaat        60
     ttgcctatga atcgtgatac agaatatttc acacagctca gtatagagag tgaagaggct       120
     tatgttctta tgaatgcggg aatgtgcatc aatacatcgg tatgccgtga atgtgccgaa       180
     caccgtgatt ttatccgctc tattctggag atactgagcg aacttgagat caacgcatct       240
     gcagcaaata cgtatgcggc aaaactcaac gaatattccg agcgtgtcag caaaatactc       300
     aaaaacatcg ccgttgttct tgcttcctga                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page