(data stored in ACNUC7421 zone)

EMBL: CP002355.PE251

CP002355.PE251       Location/Qualifiers
FT   CDS_pept        239835..240851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0252"
FT                   /product="aldo/keto reductase"
FT                   /note="COGs: COG0667 oxidoreductase (related to
FT                   aryl-alcohol dehydrogenase); InterPro IPR001395; KEGG:
FT                   sun:SUN_1152 aldo/keto reductase-family protein; PFAM:
FT                   aldo/keto reductase; SPTR: Aldo/keto reductase-family
FT                   protein; PFAM: Aldo/keto reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32919"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY06"
FT                   /protein_id="ADR32919.1"
FT                   /translation="MEYRYIGRSGLRVSPICMGTMTFGSQCDEKTAFKIMDKAYEAGVN
FT                   FFDTAELYPVPPEEKLAGLTEEMVGRWLKTKPRESIILASKVAGAASGWFVPPIRHGYT
FT                   AIDRFHIVRAIEGSLKRLDTDYIDLYQMHWPDTVVPIEESMRAFDALVQSGKVRYIGTS
FT                   NDSARGTMKSLMVSKYEKLARFESIQNNFSLLNRRDLTEIGALCREEKVSLLPYSPLAG
FT                   GVLSGKYNQDINAHGRFSDYVKSSNKRQRLMAARFMNDKTLASTQEYLRIAHEAGLHPV
FT                   TMAIAWSKQFDFVASTIIGATTPEQLDASLGAMNVTLSPEILQKLDEVHAKILYPMG"
     atggaatatc gctatattgg tcgcagcggg ctgcgcgtat cgccgatttg tatgggaacg        60
     atgacattcg ggtctcaatg cgatgaaaaa acggcattta aaattatgga taaggcgtat       120
     gaagccgggg tgaatttttt cgatacggcc gaactgtatc ccgtcccccc cgaagagaag       180
     cttgccggat tgaccgagga gatggtcggt cgttggctga aaacgaaacc gcgcgagagc       240
     atcatcctcg catccaaagt ggcaggggcg gcatcgggat ggttcgtccc tccgatccgt       300
     cacgggtata cggcgattga tcgctttcac atcgttcggg caatcgaggg ctctcttaaa       360
     cgtctggaca ccgattacat cgatctgtat cagatgcact ggcccgatac ggttgtcccc       420
     atcgaagaat cgatgcgggc gttcgatgct ttggtgcaaa gcggcaaggt acgctatatc       480
     ggtacttcca acgacagcgc gcgcgggacg atgaaatcgc tgatggtttc caaatacgaa       540
     aaactggccc gtttcgagtc gatccaaaac aacttttcgc ttcttaaccg tcgggattta       600
     accgagatcg gcgcattgtg ccgcgaagag aaggtttctt tattgccgta ttcgcctctg       660
     gcgggcgggg tgctcagcgg gaaatacaat caggacatta atgctcacgg acgctttagc       720
     gactatgtga aatcaagcaa caaacgtcag cgtctgatgg cggcacggtt tatgaacgat       780
     aaaacattgg cgtcgacgca ggaatatctg cgtatcgcgc atgaagcggg actgcatccg       840
     gtgacgatgg cgatcgcgtg gagcaagcag ttcgattttg tcgcctctac gattatcgga       900
     gcgacaacgc ctgagcagtt ggatgcaagc cttggggcga tgaatgtgac tctaagccct       960
     gaaatattac aaaaactgga tgaggtacat gcaaaaattc tttatcctat gggttag         1017
//

If you have problems or comments...

PBIL Back to PBIL home page