(data stored in ACNUC7421 zone)

EMBL: CP002355.PE253

CP002355.PE253       Location/Qualifiers
FT   CDS_pept        241360..242592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0254"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0794 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32921"
FT                   /db_xref="GOA:E4TY08"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY08"
FT                   /protein_id="ADR32921.1"
FT                   /translation="MNVSPGFSLPLRLIAPYFVAAVLFNIASMIFLFFLQSDIGLRDFR
FT                   VIGWVHAYMIGFVMMSIIGAMAQLSVVVAEVHHRYPKVFAWIGPLLGAGTVVLVIGFIY
FT                   NPFWLGIGGGLILCALAIFAFNLFITLRFSRRRTAVTRSMQWSTLFLGIGLMIGMMMAL
FT                   GYGGIIPVDPTHWRMGHIFAVFGGYVMINIMGVSTVLLPMFGACNRVSDNDYTVSFYTM
FT                   VIAVGMMLFASVLQIEILEYVALWLGIGSVMYYMFRVYLIFTSRKRVYSDIWERSVSVA
FT                   FIALALSVGSGVYGIVSGSEKAHMISFWFLTAGFLGFLITAHLYKIVPFLVWFERYAPY
FT                   VDEREVPMLHQLLPAKLADIQWGFAVAGLVMIAAAMGTGINALWQIGAFLSVLSGGVLL
FT                   AVLIRVLGDKL"
     atgaacgttt ctcccggctt ttccttgccg ctgcgtctga tcgcccccta ttttgtggcg        60
     gcggtcctgt ttaatatagc ttccatgatt tttttatttt ttttgcagag cgatatcggt       120
     ttgcgcgatt tcagagtgat cggatgggtg catgcttata tgatcggttt tgtgatgatg       180
     agcattatag gcgcgatggc tcagttgtcg gtcgtggttg cggaagttca tcaccgatac       240
     ccgaaagtat tcgcctggat aggacccttg ctgggcgcgg ggacggttgt actggtgatc       300
     ggatttatct acaacccttt ttggctgggt atcggcggcg gattgattct ttgtgcgctg       360
     gcgatttttg cttttaatct ctttattacc cttcgattca gtcgccgccg tacggcagtt       420
     actcgttcga tgcagtggag taccctgttt ttaggaatcg gtttgatgat cgggatgatg       480
     atggctttgg gatacggcgg gatcatcccc gtcgatccga cacactggcg tatggggcat       540
     atttttgccg tgttcggcgg atacgttatg atcaacatca tgggagtgag tacggtgttg       600
     cttccgatgt tcggtgcctg caatcgggtg agcgataacg attatacggt cagtttttat       660
     acgatggtca tagcggtagg gatgatgctg tttgcttcgg tattgcagat agagatactc       720
     gaatatgtgg ctctttggct ggggatcggg tcggtgatgt actatatgtt tcgggtatat       780
     ttgatattta cctccaggaa aagggtctac agcgatatat gggaacgctc ggtttccgtt       840
     gcgtttatcg ctttggcact ctccgtcgga tcgggagtat acgggatcgt atcgggaagc       900
     gaaaaagctc atatgatctc attttggttt ttgacggcag ggtttctggg atttttgatc       960
     acggcacatc tgtataagat cgtcccgttt ttggtatggt ttgagcgcta tgccccttat      1020
     gtcgatgagc gggaagtgcc gatgctccat cagcttctcc ctgccaaatt ggctgatatt      1080
     cagtggggtt ttgccgtagc cgggttggta atgatcgccg cggcaatggg aacagggatt      1140
     aatgctctat ggcagatcgg agcttttctg tcggttcttt cggggggtgt tttactggct      1200
     gtgcttataa gggttttggg cgataagtta taa                                   1233
//

If you have problems or comments...

PBIL Back to PBIL home page