(data stored in ACNUC7421 zone)

EMBL: CP002355.PE256

CP002355.PE256       Location/Qualifiers
FT   CDS_pept        244020..244316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0257"
FT                   /product="plasmid stabilization system"
FT                   /note="InterPro IPR007712; KEGG: tdn:Suden_0815 plasmid
FT                   stabilization system protein; PFAM: plasmid stabilization
FT                   system; SPTR: Plasmid stabilization system; PFAM: Plasmid
FT                   stabilisation system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32924"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY11"
FT                   /protein_id="ADR32924.1"
FT                   /translation="MEECVIRIVRNRKFTIQLQNILRFIALDKRSAALDFQHEIDTKFE
FT                   LLKTQPMMGRVSLYAEDENVRDLIYCGYTIVYEIKDEQTIRILEIFKWQDKLG"
     ttggaagagt gtgtaatccg gattgtccgc aaccgaaagt ttactatcca acttcaaaat        60
     attctccgtt ttatcgccct cgataaacgt tccgccgccc tcgattttca acatgaaata       120
     gatactaagt ttgagctttt aaagactcag ccgatgatgg gaagagtatc gttgtatgcg       180
     gaggatgaga atgtacgtga tcttatctac tgtggataca ccatcgttta tgaaattaaa       240
     gacgaacaaa cgattcgtat tttggaaatc tttaaatggc aagataaatt agggtga          297
//

If you have problems or comments...

PBIL Back to PBIL home page