(data stored in ACNUC7421 zone)

EMBL: CP002355.PE257

CP002355.PE257       Location/Qualifiers
FT   CDS_pept        244321..246162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0258"
FT                   /product="KAP P-loop domain protein"
FT                   /note="InterPro IPR011646; KEGG: plu:plu1827 hypothetical
FT                   protein; PFAM: KAP P-loop domain protein; SPTR:
FT                   Similarities with unknown protein; PFAM: KAP family P-loop
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32925"
FT                   /db_xref="InterPro:IPR011646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY12"
FT                   /protein_id="ADR32925.1"
FT                   /translation="MTQNTAVNHHIKDFLEYYIALDQPEYAVLLSGKWGSGKTFFINQV
FT                   TEKYQDSKNIVKVSLFGLKSKEDIHKKVLLKLFNIDDTHDVSVTARVVGQVLKKFTGIN
FT                   LSDMPMGWALKQEGNQNAIFIFDDLERTGIELLELHGYINELTETHKQKVILLADEDKL
FT                   KDDEKYILFKEKTIGKTFQIEQDFDTVFSSFLNGLKHSKEILQNNQSVIKSVYETAGYN
FT                   NLRSLRQGLLDFDRLINYFEPKFKNHAELMTEIIQNFFVFTFEIKSGKLDIQTLQEMTM
FT                   LRVGRMLNEEKSDDKLTPIEKVFHKYSFLSYELLLSMESWIDFFTLGILASERITDDLN
FT                   RSRYFFREEREEWLNLWYFRELEEEEFQIALKSTLDKLERNEYSDAEIVMHITGILLRL
FT                   SANRLYQNTEADIVQTMKEYIDRNRKNWDDIYTVDDFRIEQSGFGLGYQNEEMDEFKEV
FT                   KNYLLEKAKETMYEDLSAQGERLLKYLEENNISMFMEMLSETRNDILYRLPVFQNLNPE
FT                   DFVETLYHVKNQHFRSVVKTLLIRYDQVGWGVYFPLLEELDFWKSVCQIIRGEIEDKPI
FT                   NIKVTWLKYLNESIEEKIIRKIEKQMQHIEKEKNNVE"
     ttgacacaaa acactgcagt aaatcatcat ataaaagatt ttttagagta ctacattgca        60
     ttggatcaac ctgaatatgc tgtattgctt tctggaaaat ggggaagtgg aaagaccttt       120
     tttattaatc aggtaactga gaaataccaa gattcaaaaa atatcgtcaa agtaagttta       180
     tttggattga aatctaaaga ggatattcac aaaaaagttc tattaaaact atttaacatt       240
     gatgatacgc atgatgtaag cgtgacagca agagtagtgg gtcaagtttt aaaaaaattc       300
     acaggcatta atttatctga tatgccaatg ggttgggctt taaaacaaga aggcaatcag       360
     aacgcaattt tcatttttga tgatttggaa cgtacaggta tagaattatt agaattgcat       420
     ggttacatta atgaattaac tgagacacat aaacaaaaag tcattctgct tgctgatgaa       480
     gacaagttaa aagatgatga aaaatatatc cttttcaaag aaaaaacaat cggtaaaaca       540
     tttcaaatag agcaagattt tgacactgtg ttttcttcat ttttaaatgg attgaaacat       600
     tctaaagaga tacttcaaaa caatcaatct gttattaaat cagtttatga aactgccgga       660
     tataacaatc taagaagtct cagacaaggg ttattggatt ttgatcgatt gataaattat       720
     tttgagccaa aatttaaaaa tcatgctgaa ttgatgacag aaatcattca aaatttcttt       780
     gtttttacat ttgagataaa aagtggaaag cttgacatcc aaacacttca agagatgaca       840
     atgctgcgtg taggtagaat gttgaacgaa gaaaaatctg atgataaatt aacaccgatc       900
     gaaaaagttt ttcataaata cagtttttta tcgtatgaat tattattgtc tatggaaagt       960
     tggattgatt tttttacgtt aggtatatta gcgtctgaac gaatcacgga tgatctcaat      1020
     agaagccgct atttttttag agaagaacgc gaagaatggc tcaatttatg gtactttcga      1080
     gaacttgaag aagaagaatt tcaaatagca ttaaaaagta cactcgataa gctagaacga      1140
     aatgagtact cagatgctga aatcgtgatg cacatcacag gaatattatt gcgcttaagt      1200
     gcaaatagat tgtatcaaaa tacagaggct gatattgttc aaactatgaa ggaatatatt      1260
     gatcgcaatc gtaaaaattg ggatgatatc tatactgtgg atgattttcg tattgagcaa      1320
     tctggatttg gattgggata tcagaatgaa gaaatggatg agtttaaaga ggtaaaaaat      1380
     tatcttttag agaaagccaa agagacaatg tacgaagatt tgtcagcgca aggtgaaagg      1440
     cttttaaaat atttggaaga gaataatatt agcatgttca tggaaatgct ttcagaaaca      1500
     agaaatgata ttctttaccg tttgccagta tttcaaaatc tgaatccgga ggattttgtt      1560
     gaaactttgt atcatgtcaa aaatcagcac tttcgttctg tagtgaagac tcttttgata      1620
     cgttatgatc aagttggatg gggtgtatat tttccactat tggaggaact agatttctgg      1680
     aaaagtgttt gtcagattat taggggcgaa atagaagata aaccaataaa tataaaagtt      1740
     acttggttaa agtacttgaa cgaaagtata gaagaaaaaa tcattcgaaa aattgaaaaa      1800
     cagatgcagc acatagaaaa ggaaaaaaat aatgtcgaat aa                         1842
//

If you have problems or comments...

PBIL Back to PBIL home page