(data stored in ACNUC7421 zone)

EMBL: CP002355.PE258

CP002355.PE258       Location/Qualifiers
FT   CDS_pept        246152..247000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0259"
FT                   /product="Endonuclease IV"
FT                   /EC_number="3.1.21.-"
FT                   /note="COGs: COG0648 Endonuclease IV; InterPro IPR018246:
FT                   IPR001719: IPR012307; KEGG: tdn:Suden_1835 endonuclease IV;
FT                   PFAM: Xylose isomerase domain-containing protein TIM
FT                   barrel; PRIAM: Deoxyribonuclease IV (phage-T(4)-induced);
FT                   SMART: AP endonuclease family 2; SPTR: Probable
FT                   endonuclease 4; TIGRFAM: apurinic endonuclease Apn1; PFAM:
FT                   Xylose isomerase-like TIM barrel; TIGRFAM: apurinic
FT                   endonuclease (APN1)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32926"
FT                   /db_xref="GOA:E4TY13"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY13"
FT                   /protein_id="ADR32926.1"
FT                   /translation="MSNKYVGAHVSASGGVFNAPLNAMAIGAKAFALFTKNQKQWAAKP
FT                   LDDETIGLFKDNLAKSGILPKHVLPHDSYLINLGHPEEDKRQKSLEAFIDETRRCMQLG
FT                   LDRLNFHPGSHLKQISEEECIERIASSMNETLSVTNGVTLVIENTAGQGSNLGWRFEHL
FT                   SAIIERIEDKSRVGVCIDTCHMFTAGYDIRTRAAYDATWKEFDTIVGFKYLKGMHINDS
FT                   KPDLGSHVDRHDSIGKGKIGVEPFGFIMNDPRMDDIPLVLETIDETIWAQEIALLYSLQ
FT                   R"
     atgtcgaata aatatgtagg tgcccacgtc tctgccagcg gcggtgtttt taacgctccg        60
     ctcaatgcaa tggcgatcgg ggcaaaggct ttcgcccttt ttaccaaaaa ccaaaaacag       120
     tgggcggcaa agcccctcga tgatgagacg ataggacttt ttaaagacaa cctcgccaaa       180
     agcggtattc ttccaaagca cgtattgccg cacgattcgt atttgatcaa tctcggtcat       240
     cccgaagagg acaaacggca aaaatcgctc gaagcgttta tcgatgaaac gcgacgctgt       300
     atgcaactgg gacttgaccg tttgaacttc catccgggaa gccatttgaa acaaatcagc       360
     gaagaggagt gcattgagcg tatcgcgtcg agtatgaatg aaacactcag tgttacaaac       420
     ggtgtcactt tggtaatcga aaatacggcg ggccaggggt ccaatttggg gtggagattt       480
     gagcatctaa gtgccattat agagcgtata gaggacaaat cccgcgtcgg tgtgtgtatc       540
     gatacgtgcc atatgtttac cgcaggttac gatatccgaa cgcgcgcggc gtatgatgca       600
     acgtggaaag agttcgatac aattgtagga tttaagtacc ttaaagggat gcacatcaac       660
     gattccaaac ccgatttggg aagtcatgtc gaccggcacg actcgatcgg caaaggaaaa       720
     atcggggtcg agccgttcgg atttatcatg aacgatccaa gaatggatga tatccctttg       780
     gtgcttgaga caatcgatga gacgatttgg gcgcaggaga tcgcgctgct atattcacta       840
     caaaggtag                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page