(data stored in ACNUC7421 zone)

EMBL: CP002355.PE259

CP002355.PE259       Location/Qualifiers
FT   CDS_pept        247004..248215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0260"
FT                   /product="membrane protein involved in aromatic hydrocarbon
FT                   degradation"
FT                   /note="COGs: COG2067 Long-chain fatty acid transport
FT                   protein; InterPro IPR005017; KEGG: tdn:Suden_1834
FT                   hypothetical protein; PFAM: membrane protein involved in
FT                   aromatic hydrocarbon degradation; SPTR: Membrane protein;
FT                   PFAM: Outer membrane protein transport protein
FT                   (OMPP1/FadL/TodX)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32927"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY14"
FT                   /protein_id="ADR32927.1"
FT                   /translation="MKRSLVLSVALSAALSAAGYKIPENSINATALSAAYVANVHGADA
FT                   AYYNPAAMVYNDDANLLEVDATYIGLSGIDFSGSTGNYSSKKEDFLVPTLHFSSKKLGD
FT                   SGARVGFSIVAPAGLSKRWDYPAAKASAKEFTLKTIEVNPSFAVPISDSVSFGAGLRIV
FT                   RSDGVVKSDTGTPSYISRNLEGDSIDIGYNIALVYKPLKELSLAATYRSKVNLTVEGEA
FT                   DLNYLPSIHPAHAAYSGSASVAVPIPAALNLAAAYTFDTGTTIEAVFERTYWSAYKTLD
FT                   FDYDGTMNAATVAFGTPIAKNWEDTNTYRLGITQKIDQWTAMAGLAYDQTPVPEATLGY
FT                   ELPDADALIVSLGGRYKMDEHWDIGLAGLIDMKKDRSVHNSSINGEFTNARAYLVTAGI
FT                   GYRF"
     atgaagagaa gtttggtact ctctgttgca ctttcagcgg cgttatcggc tgcgggatac        60
     aaaatccctg agaactcgat caatgctacg gcactcagcg ccgcgtatgt tgccaatgtg       120
     cacggagccg acgcggcata ttataatccg gcggcgatgg tctataacga cgatgccaat       180
     ctgcttgaag tggatgcaac ctatatcgga ttaagcggaa tcgatttttc aggttcgacg       240
     ggcaattaca gttcaaaaaa agaagatttc ttggttccga ctctccattt cagttccaaa       300
     aaattaggag acagcggcgc acgtgtcggg tttagcatcg tagcccccgc aggattgtcg       360
     aaacggtggg attatcctgc cgcaaaagcg agtgcaaaag aatttacatt aaaaacgata       420
     gaggttaatc cctcttttgc tgtgcctatc agtgatagtg tgagttttgg tgccggattg       480
     agaattgtta gatcggacgg agtcgttaaa agcgatacgg gaactccgag ctatatcagc       540
     cgcaatctcg aaggggactc aattgatatc gggtacaata tcgctcttgt gtataagcct       600
     ctcaaagaac tctctttggc ggcgacatac cgttcaaaag tcaatttgac ggtagagggg       660
     gaggctgatt taaattatct tccatctatt catcctgcac acgctgctta tagcggatca       720
     gccagtgttg cggttccgat tcccgcagca ttaaatcttg cggctgcgta tacttttgac       780
     acggggacga ctatcgaagc agtgtttgag agaacatact ggtcggctta taaaacactt       840
     gattttgatt atgatgggac catgaatgct gcaacggttg cttttgggac accgattgct       900
     aaaaactggg aggataccaa tacgtatcgt ctagggatta cccaaaaaat tgaccaatgg       960
     acggcgatgg cgggcttggc atacgatcaa accccggttc ccgaagcgac gttggggtac      1020
     gagcttcctg atgcggatgc actcattgta tcgttgggcg gacggtataa aatggatgaa      1080
     cattgggaca tcggtttggc tggactgatc gatatgaaaa aagaccgctc agtgcataac      1140
     agttcgatta acggtgaatt taccaatgcc cgagcctacc tcgttactgc cggaatcggg      1200
     tatcgctttt ga                                                          1212
//

If you have problems or comments...

PBIL Back to PBIL home page