(data stored in ACNUC7421 zone)

EMBL: CP002355.PE260

CP002355.PE260       Location/Qualifiers
FT   CDS_pept        248212..249756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0261"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="COGs: COG0318 Acyl-CoA synthetase
FT                   (AMP-forming)/AMP-acid ligase II; InterPro IPR020845:
FT                   IPR000873; KEGG: wsu:WS0237 long-chain-fatty-acid--CoA
FT                   ligase; PFAM: AMP-dependent synthetase and ligase; SPTR:
FT                   Serine O-acetyltransferase; PFAM: AMP-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32928"
FT                   /db_xref="GOA:E4TY15"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY15"
FT                   /protein_id="ADR32928.1"
FT                   /translation="MIHYPYENFYAMLYGVAKENPRKNVIFIDNERYSYQRFLENVDRT
FT                   ARALEVIGVGRGDKIALICPNSVEFVQSIFAISKLGAISVPINTMLKNEEYRYILGDCG
FT                   AKAVITAFKLAQEVRGLRDDVASIEHTIWIDKAPFEDAKHLLLGEMVADHVHHHSPSPA
FT                   KLDDTAVIFYTSGTTGHPKGAMISNRNLFSNLVAAQERFDLSPKDRFIVYLPMFHSFTF
FT                   AIMVILPFFMRASFVIIPSILPFSNIVRQTLLKRVTIFMGVPDIYNALIRARLPWYFLW
FT                   FNSVRCFISGGSALSEDTLTRFRSLFKRAVMLEGYGLSECSPAVAVNLLEKQKTLSVGL
FT                   PLYGYEVKIVNDEMEELPCGEAGELIVRGECVMQGYLNNPTATAETIQNGWLRTGDIAK
FT                   IDEEGYIYIVDRIKDLIISKGINIYPRQIEEHLMLLPHIKLAAVIGVSDPHSGEVPIAF
FT                   VELEEGYETTTPAFIKAQLKEHLALFKIPKTITVVESLPKTATGKVLKRVLKQGNY"
     ttgattcact acccgtatga aaatttttat gcgatgcttt acggcgtcgc aaaagagaat        60
     ccccgtaaaa acgttatttt cattgataat gaacgttatt cgtatcagag atttttagag       120
     aatgtcgata gaactgcccg tgcgcttgaa gtgatcggtg tcgggagagg ggataagata       180
     gccctgattt gtcccaacag tgtcgaattc gtccaaagta tttttgccat cagcaaactc       240
     ggagcgatca gcgtaccgat taacacgatg ctcaaaaatg aagaataccg ctatattctg       300
     ggtgattgcg gtgccaaagc ggtgattact gctttcaagc tcgctcaaga ggtacgtggg       360
     ctgcgcgatg atgttgcatc gattgaacat acgatttgga tagataaggc gccgtttgaa       420
     gatgcaaaac atctgctatt gggtgagatg gttgccgatc atgtgcatca ccactcgccc       480
     tcaccagcaa agttggatga tacggcggtc attttttata cgtccgggac gacgggacac       540
     cctaaagggg ccatgatcag caatcgcaac cttttctcca acctcgtcgc cgcgcaggaa       600
     cggtttgatc taagcccgaa agaccgtttc attgtctatc ttccaatgtt tcactcgttt       660
     acgtttgcga tcatggtaat acttccgttt tttatgcggg cctcttttgt cattatcccc       720
     tccattttgc cctttagcaa tattgttcgg cagacgcttc taaagagagt aactattttt       780
     atgggagttc ccgacatata taacgccctg atccgtgcaa gattgccgtg gtattttcta       840
     tggtttaatt ctgtccgctg ttttatctca ggcggttcgg ctctgagcga agataccctg       900
     acccggtttc ggtcgctttt taaacgagcc gtgatgttgg agggttacgg tctcagcgaa       960
     tgttctccgg cggtagccgt caatctgctc gaaaaacaaa aaaccctttc cgtcgggctg      1020
     ccgctgtacg gatacgaagt aaaaatcgtc aatgacgaga tggaagagct cccatgcggg      1080
     gaagcgggag aactgatcgt gaggggcgag tgcgttatgc aggggtatct aaacaatccg      1140
     accgcgacgg cggagacgat acaaaacgga tggctccgca ccggtgatat cgctaaaatc      1200
     gacgaagagg ggtatattta tatcgtcgat cggatcaaag atctgatcat ctctaaaggg      1260
     atcaatatct atccgcgaca gatcgaagaa caccttatgc tgctcccgca tatcaagctc      1320
     gctgccgtca tcggtgtgag cgatcctcac agcggggaag ttccgattgc ttttgtcgag      1380
     ttggaagagg ggtatgagac gacgactccc gcctttatca aagctcagct caaagaacat      1440
     ttggcattgt ttaaaatccc taaaaccatt accgtggtag aatcacttcc aaagactgct      1500
     accggcaaag tactcaaacg agtattaaaa caaggaaact attga                      1545
//

If you have problems or comments...

PBIL Back to PBIL home page