(data stored in ACNUC7421 zone)

EMBL: CP002355.PE262

CP002355.PE262       Location/Qualifiers
FT   CDS_pept        251606..252700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0263"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
FT                   InterPro IPR004090: IPR004089; KEGG: cla:Cla_1032
FT                   MCP-domain signal transduction protein; PFAM: chemotaxis
FT                   sensory transducer; SMART: chemotaxis sensory transducer;
FT                   SPTR: Methyl-accepting chemotaxis protein; PFAM:
FT                   Methyl-accepting chemotaxis protein (MCP) signaling domain;
FT                   Myosin-like coiled-coil protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32930"
FT                   /db_xref="GOA:E4TY17"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR025991"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY17"
FT                   /protein_id="ADR32930.1"
FT                   /translation="MGWFSDDTELKEELSVLQKENTALRDENQELARKLQECEAKIAKE
FT                   DERHRCENASMIMTYQNEQLKKNLVDVQGNMASSVASSKENIAQSTALLENIVELGQKA
FT                   SGISHTLEGLNHLALESMDTVKALSDRAQDVASILVLIKDISDQTNLLALNAAIEAARA
FT                   GEHGRGFAVVADEVRKLADRTDKAISEINISLQSMKQDVTTIGEKFDQVQESIADSNES
FT                   IGSFNANMDHNAQMMRETFASTEHTAERIFMSLAKLDHIVWKVNTYLSAITRKEQFNFV
FT                   DHHNCRLGKWYYEGEGADFFKKTPSYSALETPHSVVHNSTHKIFDLMKTESVGSERFVK
FT                   VFEEMEHASDGVFATLDRMLQEKN"
     atgggttggt ttagtgatga tacagagttg aaagaagaac tctcagtatt gcaaaaagag        60
     aatactgcac tacgagatga gaatcaagaa cttgcaagaa agctccaaga atgtgaagca       120
     aaaatcgcga aagaggatga acggcatcgt tgtgaaaacg catcgatgat catgacctat       180
     caaaatgagc agcttaagaa aaatcttgtc gatgttcagg ggaatatggc ctcttccgtt       240
     gcctcttcaa aagagaatat cgcgcaatct accgcacttt tagaaaatat cgttgaactc       300
     gggcaaaagg cctccggaat ttcacatacg ttagaggggc taaaccattt ggcactggag       360
     tctatggata cggtaaaagc actctctgat cgggctcagg acgtggcaag tatattggta       420
     ttgattaaag atatctccga tcaaacgaat ctcttggctc ttaatgcggc gattgaagcg       480
     gcccgtgccg gcgagcacgg gcgggggttc gccgttgttg ccgatgaagt gcgcaaactt       540
     gccgatcgaa ccgataaagc gatcagcgag atcaatattt cattacaatc gatgaaacag       600
     gacgtaacga cgatcggtga aaaatttgat caggtacaag aaagcattgc agactccaat       660
     gaatcgatcg gaagctttaa tgccaatatg gatcataatg cgcagatgat gcgtgaaacc       720
     tttgccagca ccgaacatac ggctgagaga atttttatga gtttggcgaa actcgatcat       780
     attgtctgga aagtcaatac gtatctctcc gcaatcacca gaaaagagca gtttaatttt       840
     gtcgatcacc ataattgccg actaggtaaa tggtactatg aaggtgaagg tgctgatttc       900
     ttcaagaaaa cgccaagcta ttcggcactt gaaacacctc attcggttgt ccataactcg       960
     acccataaga ttttcgattt gatgaaaaca gagagtgtcg gatctgaacg gtttgtcaaa      1020
     gtttttgaag agatggaaca tgcaagcgac ggtgtgtttg cgacgttgga tagaatgctt      1080
     caagagaaaa attaa                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page